KEGG   Homo sapiens (human): 1592
Entry
1592              CDS       T01001                                 

Gene name
CYP26A1, CP26, CYP26, P450RAI, P450RAI1
Definition
(RefSeq) cytochrome P450 family 26 subfamily A member 1
  KO
K07437  cytochrome P450 family 26 subfamily A [EC:1.14.14.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Drug target
Talarozole: D09385
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    1592 (CYP26A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1592 (CYP26A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     1592 (CYP26A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP26 family
   1592 (CYP26A1)
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 1592
NCBI-ProteinID: NP_000774
OMIM: 602239
HGNC: 2603
Ensembl: ENSG00000095596
Vega: OTTHUMG00000018765
Pharos: O43174(Tclin)
UniProt: O43174
Position
10q23.33
AA seq 497 aa
MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQM
VLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTIL
GSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPE
VKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKAR
NLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFG
GHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVI
KETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTV
YPVDNLPARFTHFHGEI
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggggctcccggcgctgctggccagtgcgctctgcaccttcgtgctgccgctgctgctc
ttcctggctgcgatcaagctctgggacctgtactgcgtgagcggccgcgaccgcagttgt
gccctcccattgccccccgggactatgggcttccccttctttggggaaaccttgcagatg
gtactgcagcggaggaagttcctgcagatgaagcgcaggaaatacggcttcatctacaag
acgcatctgttcgggcggcccaccgtacgggtgatgggcgcggacaatgtgcggcgcatc
ttgctcggagagcaccggctggtgtcggtccactggccagcgtcggtgcgcaccattctg
ggatctggctgcctctctaacctgcacgactcctcgcacaagcagcgcaagaaggtgatt
atgcgggccttcagccgcgaggcactcgaatgctacgtgccggtgatcaccgaggaagtg
ggcagcagcctggagcagtggctgagctgcggcgagcgcggcctcctggtctaccccgag
gtgaagcgcctcatgttccgaatcgccatgcgcatcctactgggctgcgaaccccaactg
gcgggcgacggggactccgagcagcagcttgtggaggccttcgaggaaatgacccgcaat
ctcttctcgctgcccatcgacgtgcccttcagcgggctgtaccggggcatgaaggcgcgg
aacctcattcacgcgcgcatcgagcagaacattcgcgccaagatctgcgggctgcgggca
tccgaggcgggccagggctgcaaagacgcgctgcagctgttgatcgagcactcgtgggag
aggggagagcggctggacatgcaggcactaaagcaatcttcaaccgaactcctctttgga
ggacacgaaaccacggccagtgcagccacatctctgatcacttacctggggctctaccca
catgttctccagaaagtgcgagaagagctgaagagtaagggtttactttgcaagagcaat
caagacaacaagttggacatggaaattttggaacaacttaaatacatcgggtgtgttatt
aaggagacccttcgactgaatcccccagttccaggagggtttcgggttgctctgaagact
tttgaattaaatggataccagattcccaagggctggaatgttatctacagtatctgtgat
actcatgatgtggcagagatcttcaccaacaaggaagaatttaatcctgaccgattcatg
ctgcctcacccagaggatgcatccaggttcagcttcattccatttggaggaggccttagg
agctgtgtaggcaaagaatttgcaaaaattcttctcaaaatatttacagtggagctggcc
aggcattgtgactggcagcttctaaatggacctcctacaatgaaaaccagtcccaccgtg
tatcctgtggacaatctccctgcaagattcacccatttccatggggaaatctga

DBGET integrated database retrieval system