KEGG   Homo sapiens (human): 1593Help
Entry
1593              CDS       T01001                                 

Gene name
CYP27A1, CP27, CTX, CYP27
Definition
(RefSeq) cytochrome P450 family 27 subfamily A member 1
  KO
K00488  cholestanetriol 26-monooxygenase [EC:1.14.15.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00120  Primary bile acid biosynthesis
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
hsa04979  Cholesterol metabolism
Module
hsa_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Disease
H00151  Cerebrotendinous xanthomatosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    1593 (CYP27A1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    1593 (CYP27A1)
  09154 Digestive system
   04979 Cholesterol metabolism
    1593 (CYP27A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1593 (CYP27A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.15  cholestanetriol 26-monooxygenase
     1593 (CYP27A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP27 family
   1593 (CYP27A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1593
NCBI-ProteinID: NP_000775
OMIM: 606530
HGNC: 2605
Ensembl: ENSG00000135929
Vega: OTTHUMG00000048238
Pharos: Q02318(Tchem)
UniProt: Q02318
Position
2q35
AA seq 531 aa AA seqDB search
MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEI
PRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQ
EGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNE
VIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTF
VRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAA
GPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEA
LHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPK
NTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRR
IAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgctgggctgcgcgaggctgaggtgggcgctgcgaggggccggccgtggcctc
tgcccccacggggccagagccaaggccgcgatccctgccgccctcccctcggacaaggcc
accggagctcccggagccgggcctggtgtccggcggcggcaacggagcttagaggagatt
ccacgtctaggacagctgcgcttcttctttcagctgttcgttcaaggctatgccctgcaa
ctgcaccagttacaggtgctttacaaggccaagtacggtccaatgtggatgtcctactta
gggcctcagatgcacgtgaacctggccagtgccccgctcttggagcaagtgatgcggcaa
gagggcaagtacccagtacggaacgacatggagctatggaaggagcaccgggaccagcac
gacctgacctatgggccgttcaccacggaaggacaccactggtaccagctgcgccaggct
ctgaaccagcggttgctgaagccagcggaagcagcgctctatacggatgctttcaatgag
gtgattgatgactttatgactcgactggaccagctgcgggcagagagtgcttcggggaac
caggtgtcggacatggctcaactcttctactactttgccttggaagctatttgctacatc
ctgttcgagaaacgcattggctgcctgcagcgatccatccccgaggacaccgtgaccttc
gtcagatccatcgggttaatgttccagaactcactctatgccaccttcctccccaagtgg
actcgccccgtgctgcctttctggaagcgatacctggatggttggaatgccatcttttcc
tttgggaagaagctgattgatgagaagctcgaagatatggaggcccaactgcaggcagca
gggccagatggcatccaggtgtctggctacctgcacttcttactggccagtggacagctc
agtcctcgggaggccatgggcagcctgcctgagctgctcatggctggagtggacacgaca
tccaacacgctgacatgggccctgtaccacctctcaaaggaccctgagatccaggaggcc
ttgcacgaggaagtggtgggtgtggtgccagccgggcaagtgccccagcacaaggacttt
gcccacatgccgttgctcaaagctgtgcttaaggagactctgcgtctctaccctgtggtc
cccacaaactcccggatcatagaaaaggaaattgaagttgatggcttcctcttccccaag
aacacccagtttgtgttctgccactatgtggtgtcccgggaccccactgccttctctgag
cctgaaagcttccagccccaccgctggctgagaaacagccagcctgctacccccaggatc
cagcacccatttggctctgtgccctttggctatggggtccgggcctgcctgggccgcagg
attgcagagctggagatgcagctactcctcgcaaggctgatccagaagtacaaggtggtc
ctggccccggagacgggggagttgaagagtgtggcccgcattgtcctggttcccaataag
aaagtgggcctgcagttcctgcagagacagtgctga

DBGET integrated database retrieval system