KEGG   Homo sapiens (human): 159371
Entry
159371            CDS       T01001                                 
Symbol
SLC35G1, C10orf60, POST, TMEM20
Name
(RefSeq) solute carrier family 35 member G1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: EamA PUNUT
Other DBs
NCBI-GeneID: 159371
NCBI-ProteinID: NP_001128130
OMIM: 617167
HGNC: 26607
Ensembl: ENSG00000176273
Pharos: Q2M3R5(Tbio)
UniProt: Q2M3R5
Position
10:93893978..93909830
AA seq 365 aa
MRPQDSTGVAELQEPGLPLTDDAPPGATEEPAAAEAAGAPDRGRCWLCLSSPCCSRTEPE
AKKKAPCPGLGLFYTLLSAFLFSVGSLFVKKVQDVHAVEISAFRCVFQMLVVIPCLIYRK
TGFIGPKGQRIFLILRGVLGSTAMMLIYYAYQTMSLADATVITFSSPVFTSIFAWICLKE
KYSPWDALFTVFTITGVILIVRPPFLFGSDTSGMEESYSGHLKGTFAAIGSAVFAASTLV
ILRKMGKSVDYFLSIWYYVVLGLVESVIILSVLGEWSLPYCGLDRLFLIFIGLFGLGGQI
FITKALQIEKAGPVAIMKTMDVVFAFIFQIIFFNNVPTWWTVGGALCVVASNVGAAIRKW
YQSSK
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgcggcctcaggacagcaccggggtcgcggagctccaggagcccgggctgccgctaacg
gacgatgcacccccgggcgccactgaggagccggcggccgccgaggcagctggggcgcca
gaccgcggtaggtgctggctctgcctttcctcgccgtgttgctcccgcaccgagccggaa
gccaagaagaaagcaccctgtcctggacttggcttgttttacacattattgtctgccttc
cttttctcagtgggctctttatttgttaaaaaagtgcaagacgtccatgctgtagagatt
agtgcgtttcgatgtgtgttccaaatgctagttgttatcccttgcttaatatacagaaaa
actgggtttataggcccaaaaggtcaacgaattttcctcattctcagaggagtccttggt
tctaccgccatgatgcttatatactatgcttaccagacaatgtccctcgctgatgccaca
gttatcacgtttagcagtccagtgtttacgtccatatttgcttggatatgtctcaaggaa
aaatatagcccttgggatgctcttttcaccgtgttcacaatcactggagtgatccttatc
gtgagaccaccatttttgtttggttccgacacttcggggatggaagaaagctattcaggc
caccttaagggaacattcgcagcaattggaagtgccgtatttgctgcatcgactctagtt
atcctaagaaaaatgggaaaatctgtggactactttctgagcatttggtattatgtagta
cttggcctcgttgaaagtgtcatcatcctctctgtattaggagagtggagtctgccttac
tgtgggttggacaggctatttctcatattcattgggctctttggtttggggggtcagata
tttatcacaaaagcacttcaaatagaaaaagcagggccagtagcaataatgaagacaatg
gatgtggtctttgcttttatctttcagattattttctttaataatgtgccaacgtggtgg
acagtgggtggtgctctctgcgtagtagccagtaatgttggagcggccattcgtaaatgg
taccaaagttccaaatga

DBGET integrated database retrieval system