KEGG   Homo sapiens (human): 1595Help
Entry
1595              CDS       T01001                                 

Gene name
CYP51A1, CP51, CYP51, CYPL1, LDM, P450-14DM, P450L1
Definition
(RefSeq) cytochrome P450 family 51 subfamily A member 1
  KO
K05917  sterol 14alpha-demethylase [EC:1.14.14.154 1.14.15.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Drug target
Azalanstat dihydrochloride: D03025
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    1595 (CYP51A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1595 (CYP51A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.154  sterol 14alpha-demethylase
     1595 (CYP51A1)
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.36  sterol 14alpha-demethylase (ferredoxin)
     1595 (CYP51A1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP51 family
   1595 (CYP51A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1595
NCBI-ProteinID: NP_000777
OMIM: 601637
HGNC: 2649
Ensembl: ENSG00000001630
Vega: OTTHUMG00000131131
Pharos: Q16850(Tchem)
UniProt: Q16850 A0A0C4DFL7
Structure
PDB: 

Position
7q21.2
AA seq 509 aa AA seqDB search
MAAAAGMLLLGLLQAGGSVLGQAMEKVTGGNLLSMLLIACAFTLSLVYLIRLAAGHLVQL
PAGVKSPPYIFSPIPFLGHAIAFGKSPIEFLENAYEKYGPVFSFTMVGKTFTYLLGSDAA
ALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSI
IEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGF
SHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGR
PLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTY
DQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDS
WVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDL
IDGYFPTVNYTTMIHTPENPVIRYKRRSK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggctgggatgctgctgctgggcttgctgcaggcgggtgggtcggtgctg
ggccaggcgatggagaaggtgacaggcggcaacctcttgtccatgctgctgatcgcctgc
gccttcaccctcagcctggtctacctgatccgtctggccgccggccacctggtccagctg
cccgcaggggtgaaaagtcctccatacattttctccccaattccattccttgggcatgcc
atagcatttgggaaaagtccaattgaatttctagaaaatgcatatgagaagtatggacct
gtatttagttttaccatggtaggcaagacatttacttaccttctggggagtgatgctgct
gcactgctttttaatagtaaaaatgaagacctgaatgcagaagatgtctacagtcgcctg
acaacacctgtgtttgggaagggagttgcatacgatgtgcctaatccagttttcttggag
cagaagaaaatgttaaaaagtggccttaacatagcccactttaaacagcatgtttctata
attgaaaaagaaacaaaggaatactttgagagttggggagaaagtggagaaaaaaatgtg
tttgaagctctttctgagctcataattttaacagctagccattgtttgcatggaaaggaa
atcagaagtcaactcaatgaaaaggtagcacagctgtatgcagatttggatggaggtttc
agccatgcagcctggctcttaccaggttggctgcctttgcctagtttcagacgcagggac
agagctcatcgggaaatcaaggatattttctataaggcaatccagaaacgcagacagtct
caagaaaaaattgatgacattctccaaactttactagatgctacatacaaggatgggcgt
cctttgactgatgatgaagtagcagggatgcttattggattactcttggcagggcagcat
acatcctcaactactagtgcttggatgggcttctttttggccagagacaaaacacttcaa
aaaaaatgttatttagaacagaaaacagtctgtggagagaatctgcctcctttaacttat
gaccagctcaaggatctaaatttacttgatcgctgtataaaagaaacattaagacttaga
cctcctataatgatcatgatgagaatggccagaactcctcagactgtggcagggtatacc
attcctccaggacatcaggtgtgtgtttctcccactgtcaatcaaagacttaaagactca
tgggtagaacgcctggactttaatcctgatcgctacttacaggataacccagcatcaggg
gaaaagtttgcctatgtgccatttggagctgggcgtcatcgttgtattggggaaaatttt
gcctatgttcaaattaagacaatttggtccactatgcttcgtttatatgaatttgatctc
attgatggatactttcccactgtgaattatacaactatgattcacacccctgaaaaccca
gttatccgttacaaacgaagatcaaaatga

DBGET integrated database retrieval system