KEGG   Homo sapiens (human): 160Help
Entry
160               CDS       T01001                                 

Gene name
AP2A1, ADTAA, AP2-ALPHA, CLAPA1
Definition
(RefSeq) adaptor related protein complex 2 subunit alpha 1
  KO
K11824  AP-2 complex subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    160 (AP2A1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    160 (AP2A1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    160 (AP2A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    160 (AP2A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    160 (AP2A1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    160 (AP2A1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    160 (AP2A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   160 (AP2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Cnd1 HEAT_2 RIX1 Dymeclin
Motif
Other DBs
NCBI-GeneID: 160
NCBI-ProteinID: NP_055018
OMIM: 601026
HGNC: 561
Ensembl: ENSG00000196961
Vega: OTTHUMG00000183253
Pharos: O95782(Tbio)
UniProt: O95782
Position
19q13.33
AA seq 977 aa AA seqDB search
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASP
DLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCVSLAVSRLSRIVSSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRLVECLETVLNKAQEPPKSKKV
QHSNAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAI
REEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAA
KTVFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRAL
LLSTYIKFINLFPETKATIQGVLRAGSQLRNADVELQQRAVEYLTLSSVASTDVLATVLE
EMPPFPERESSILAKLKRKKGPGAGSALDDGRRDPSSNDINGGMEPTPSTVSTPSPSADL
LGLRAAPPPAAPPASAGAGNLLVDVFDGPAAQPSLGPTPEEAFLSELEPPAPESPMALLA
DPAPAADPGPEDIGPPIPEADELLNKFVCKNNGVLFENQLLQIGVKSEFRQNLGRMYLFY
GNKTSVQFQNFSPTVVHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLL
SVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPMD
AEVTKAKLLGFGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQMYRLTLRT
SKEPVSRHLCELLAQQF
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgtgtccaagggcgatgggatgcgggggctcgcggtgttcatctccgacatc
cggaactgtaagagcaaagaggcggaaattaagagaatcaacaaggaactggccaacatc
cgctccaagttcaaaggagacaaagccttggatggctacagtaagaaaaaatatgtgtgt
aaactgcttttcatcttcctgcttggccatgacattgactttgggcacatggaggctgtg
aatctgttgagttccaataaatacacagagaagcaaataggttacctgttcatttctgtg
ctggtgaactcgaactcggagctgatccgcctcatcaacaacgccatcaagaatgacctg
gccagccgcaaccccaccttcatgtgcctggccctgcactgcatcgccaacgtgggcagc
cgggagatgggcgaggcctttgccgctgacatcccccgcatcctggtggccggggacagc
atggacagtgtcaagcagagtgcggccctgtgcctccttcgactgtacaaggcctcgcct
gacctggtgcccatgggcgagtggacggcgcgtgtggtacacctgctcaatgaccagcac
atgggtgtggtcacggccgccgtcagcctcatcacctgtctctgcaagaagaacccagat
gacttcaagacgtgcgtctctctggctgtgtcgcgcctgagccggatcgtctcctctgcc
tccaccgacctccaggactacacctactacttcgtcccagcaccctggctctcggtgaag
ctcctgcggctgctgcagtgctacccgcctccagaggatgcggctgtgaaggggcggctg
gtggaatgtctggagactgtgctcaacaaggcccaggagccccccaaatccaagaaggtg
cagcattccaacgccaagaacgccatcctcttcgagaccatcagcctcatcatccactat
gacagtgagcccaacctcctggttcgggcctgcaaccagctgggccagttcctgcagcac
cgggagaccaacctgcgctacctggccctggagagcatgtgcacgctggccagctccgag
ttctcccatgaagccgtcaagacgcacattgacaccgtcatcaatgccctcaagacggag
cgggacgtcagcgtgcggcagcgggcggctgacctcctctacgccatgtgtgaccggagc
aatgccaagcagatcgtgtcggagatgctgcggtacctggagacggcagactacgccatc
cgcgaggagatcgtcctgaaggtggccatcctggccgagaagtacgccgtggactacagc
tggtacgtggacaccatcctcaacctcatccgcattgcgggcgactacgtgagtgaggag
gtgtggtaccgtgtgctacagatcgtcaccaaccgtgatgacgtccagggctatgccgcc
aagaccgtctttgaggcgctccaggcccctgcctgtcacgagaacatggtgaaggttggc
ggctacatccttggggagtttgggaacctgattgctggggacccccgctccagcccccca
gtgcagttctccctgctccactccaagttccatctgtgcagcgtggccacgcgggcgctg
ctgctgtccacctacatcaagttcatcaacctcttccccgagaccaaggccaccatccag
ggcgtcctgcgggccggctcccagctgcgcaatgctgacgtggagctgcagcagcgagcc
gtggagtacctcaccctcagctcagtggccagcaccgacgtcctggccacggtgctggag
gagatgccgcccttccccgagcgcgagtcgtccatcctggccaagctgaaacgcaagaag
gggccaggggccggcagcgccctggacgatggccggagggaccccagcagcaacgacatc
aacgggggcatggagcccacccccagcactgtgtcgacgccctcgccctccgccgacctc
ctggggctgcgggcagcccctcccccggcagcacccccggcttctgcaggagcagggaac
cttctggtggacgtcttcgatggcccggccgcccagcccagcctggggcccacccccgag
gaggccttcctcagcgagctggagccgcctgcccccgagagccccatggctttgctggct
gacccagctccagctgctgacccaggtcctgaggacatcggccctcccattccggaagcc
gatgagttgctgaataagtttgtgtgtaagaacaacggggtcctgttcgagaaccagctg
ctgcagatcggagtcaagtcagagttccgacagaacctgggccgcatgtatctcttctat
ggcaacaagacctcggtgcagttccagaatttctcacccactgtggttcacccgggagac
ctccagactcagctggctgtgcagaccaagcgcgtggcggcgcaggtggacggcggcgcg
caggtgcagcaggtgctcaatatcgagtgcctgcgggacttcctgacgcccccgctgctg
tccgtgcgcttccggtacggtggcgccccccaggccctcaccctgaagctcccagtgacc
atcaacaagttcttccagcccaccgagatggcggcccaggatttcttccagcgctggaag
cagctgagcctccctcaacaggaggcgcagaaaatcttcaaagccaaccaccccatggac
gcagaagttactaaggccaagcttctggggtttggctctgctctcctggacaatgtggac
cccaaccctgagaacttcgtgggggcggggatcatccagactaaagccctgcaggtgggc
tgtctgcttcggctggagcccaatgcccaggcccagatgtaccggctgaccctgcgcacc
agcaaggagcccgtctcccgtcacctgtgtgagctgctggcacagcagttctga

DBGET integrated database retrieval system