KEGG   Homo sapiens (human): 1606
Entry
1606              CDS       T01001                                 
Symbol
DGKA, DAGK, DAGK1, DGK-alpha
Name
(RefSeq) diacylglycerol kinase alpha
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    1606 (DGKA)
   00564 Glycerophospholipid metabolism
    1606 (DGKA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    1606 (DGKA)
   04072 Phospholipase D signaling pathway
    1606 (DGKA)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    1606 (DGKA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     1606 (DGKA)
SSDB
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 C1_2 EF-hand_8
Other DBs
NCBI-GeneID: 1606
NCBI-ProteinID: NP_001336
OMIM: 125855
HGNC: 2849
Ensembl: ENSG00000065357
Pharos: P23743(Tbio)
UniProt: P23743 A0A024RB23
Structure
Position
12:55931162..55954023
AA seq 735 aa
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIY
LEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFK
LYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEW
VRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKY
TVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHC
VWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNL
STSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL
FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQ
NLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIM
REKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVL
NIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLE
GAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPML
MGPPPRSTNFFGFLS
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggccaaggagaggggcctaataagccccagtgattttgcccagctgcaaaaatacatg
gaatactccaccaaaaaggtcagtgatgtcctaaagctcttcgaggatggcgagatggct
aaatatgtccaaggagatgccattgggtacgagggattccagcaattcctgaaaatctat
ctcgaagtggataatgttcccagacacctaagcctggcactgtttcaatcctttgagact
ggtcactgcttaaatgagacaaatgtgacaaaagatgtggtgtgtctcaatgatgtttcc
tgctacttttcccttctggagggtggtcggccagaagacaagttagaattcaccttcaag
ctgtacgacacggacagaaatgggatcctggacagctcagaagtggacaaaattatccta
cagatgatgcgagtggctgaatacctggattgggatgtgtctgagctgaggccgattctt
caggagatgatgaaagagattgactatgatggcagtggctctgtctctcaagctgagtgg
gtccgggctggggccaccaccgtgccactgctagtgctgctgggtctggagatgactctg
aaggacgacggacagcacatgtggaggcccaagaggttccccagaccagtctactgcaat
ctgtgcgagtcaagcattggtcttggcaaacagggactgagctgtaacctctgtaagtac
actgttcacgaccagtgtgccatgaaagccctgccttgtgaagtcagcacctatgccaag
tctcggaaggacattggtgtccaatcacatgtgtgggtgcgaggaggctgtgagtccggg
cgctgcgaccgctgtcagaaaaagatccggatctaccacagtctgaccgggctgcattgt
gtatggtgccacctagagatccacgatgactgcctgcaagcggtgggccatgagtgtgac
tgtgggctgctccgggatcacatcctgcctccatcttccatctatcccagtgtcctggcc
tctggaccggatcgtaaaaatagcaaaacaagccagaagaccatggatgatttaaatttg
agcacctctgaggctctgcggattgaccctgttcctaacacccacccacttctcgtcttt
gtcaatcctaagagtggcgggaagcaggggcaaagggtgctctggaagttccagtatata
ttaaaccctcgacaggtgttcaacctcctaaaggatggtcctgagatagggctccgatta
ttcaaggatgttcctgatagccggattttggtgtgtggtggagacggcacagtaggctgg
attctagagaccattgacaaagctaacttgccagttttgcctcctgttgctgtgttgccc
ctgggtactggaaatgatctggctcgatgcctaagatggggaggaggttatgaaggacag
aatctggcaaagatcctcaaggatttagagatgagtaaagtggtacatatggatcgatgg
tctgtggaggtgatacctcaacaaactgaagaaaaaagtgacccagtcccctttcaaatc
atcaataactacttctctattggcgtggatgcctctattgctcatcgattccacatcatg
cgagagaaatatccggagaagttcaacagcagaatgaagaacaagctatggtacttcgaa
tttgccacatctgaatccatcttctcaacatgcaaaaagctggaggagtctttgacagtt
gagatctgtgggaaaccgctggatctgagcaacctgtccctagaaggcatcgcagtgcta
aacatccctagcatgcatggtggctccaacctctggggtgataccaggagaccccatggg
gatatctatgggatcaaccaggccttaggtgctacagctaaagtcatcaccgaccctgat
atcctgaaaacctgtgtaccagacctaagtgacaagagactggaagtggttgggctggag
ggtgcaattgagatgggccaaatctataccaagctcaagaatgctggacgtcggctggcc
aagtgctctgagatcaccttccacaccacaaaaacccttcccatgcaaattgacggagaa
ccctggatgcagacgccctgtacaatcaagatcacccacaagaaccagatgcccatgctc
atgggcccacccccccgctccaccaatttctttggcttcttgagctaa

DBGET integrated database retrieval system