KEGG   Homo sapiens (human): 160762
Entry
160762            CDS       T01001                                 
Symbol
CCDC63, ODA5
Name
(RefSeq) coiled-coil domain containing 63
  KO
K23732  coiled-coil domain-containing protein 63/114
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    160762 (CCDC63)
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    160762 (CCDC63)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  ODA docking complex
   160762 (CCDC63)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  Others
   160762 (CCDC63)
SSDB
Other DBs
NCBI-GeneID: 160762
NCBI-ProteinID: NP_689804
OMIM: 617969
HGNC: 26669
Ensembl: ENSG00000173093
Pharos: Q8NA47(Tdark)
UniProt: Q8NA47
Position
12:110844486..110907535
AA seq 563 aa
MSVLKKNRRKDSDTPQEPSEKAKEQQAEAELRKLRQQFRKMVESRKSFKFRNQQKIASQY
KEIKTLKTEQDEITLLLSLMKSSRNMNRSEKNYMELRLLLQTKEDYEALIKSLKVLLAEL
DEKILQMEKKIANQKQIFAKMQEANNPRKLQKQIHILETRLNLVTVHFDKMLTTNAKLRK
EIEDLRFEKAAYDNVYQQLQHCLLMEKKTMNLAIEQSSQAYEQRVEAMARMAAMKDRQKK
DTSQYNLEIRELERLYAHESKLKSFLLVKLNDRNEFEEQAKREEALKAKKHVKKNRGESF
ESYEVAHLRLLKLAESGNLNQLIEDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDE
IILLRSQQKLSHDDNHSVLRQLEDKLRKTTEEADMYESKYGEVSKTLDLLKNSVEKLFKK
INCDATKILVQLGETGKVTDINLPQYFAIIEKKTNDLLLLETYRRILEVEGAEAEIPPPF
INPFWGGSALLKPPEPIKVIPPVLGADPFSDRLDDVEQPLDHSSLRQLVLDNYILKENRS
KEVRGDSLPEKVDDFRSRKKVTM
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgtctgtgttgaagaagaacaggagaaaagactccgacactccccaggaaccttcggag
aaggccaaagagcagcaggcggaggcagagctccggaagctaaggcagcagttcaggaag
atggtggaaagccggaagtcttttaagttccgaaaccagcagaagattgcgagtcagtac
aaggagatcaagaccctgaagacagagcaggatgagatcaccctactgttgagtctcatg
aaatcctcgaggaacatgaatcggagtgagaagaactacatggagctgcgactcctgctc
caaactaaggaggactatgaggcattgattaaatccctgaaagtgctgttggctgaactg
gatgagaagattcttcagatggaaaaaaaaatcgcaaaccaaaaacagattttcgcaaaa
atgcaggaggccaataacccccggaaactgcagaaacagattcacattttggaaacccgt
ttgaatctcgtcactgttcactttgacaagatgctgaccactaatgccaagctccggaag
gagattgaagacctacgatttgagaaggctgcttatgacaatgtctaccagcagctccag
cactgcctgttgatggagaagaaaaccatgaacttggccattgagcaatcttctcaggcc
tatgagcagagggtggaggccatggctcgaatggctgccatgaaagaccgccagaagaag
gacacctctcagtacaacctggagatccgagagctggagcgtctctatgcccatgagagc
aagctcaagtccttcctgctcgtcaagctgaatgatcgcaatgaattcgaggagcaggcc
aaaagggaggaagctctcaaggcaaagaagcatgtcaagaagaacaggggagagagtttt
gagagctatgaggtggcccacctccggctgctgaagctggctgagagtgggaacctaaac
cagctcattgaagattttctggccaaggaggagaagaattttgctcggttcacgtatgtc
acggagctcaacaacgacatggagatgatgcacaagaggacccaacgaatccaggacgag
atcatcctcttgcgatcccagcagaaattgtcccacgatgacaaccactctgtcctgaga
cagctggaggataaactgaggaagaccacggaggaggcagatatgtatgagagcaagtac
ggggaggtcagcaagaccttggatctattgaagaactcagtggagaaactgttcaagaag
ataaactgtgacgccaccaagatcctggtgcagttaggggagacggggaaagtcactgac
atcaaccttccgcagtattttgccatcattgaaaagaagaccaacgacctgctgctgttg
gagacctacaggcgcatcctggaagtggaaggggcagaggctgagatcccgccacccttc
atcaaccctttctggggtggctctgccctcctcaagcccccagaacccatcaaagtcatc
cccccagtgctgggggctgaccccttcagcgacaggttggatgatgtggaacagcccctg
gaccacagcagccttcggcagctggttctcgacaattatatcctgaaggagaatcggagt
aaggaagtgcgcggagacagcctgcctgagaaggtggatgacttcagatccaggaagaaa
gtaaccatgtga

DBGET integrated database retrieval system