KEGG   Homo sapiens (human): 160762Help
Entry
160762            CDS       T01001                                 

Gene name
CCDC63, ODA5
Definition
(RefSeq) coiled-coil domain containing 63
  KO
K23732   
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 160762
NCBI-ProteinID: NP_689804
OMIM: 617969
HGNC: 26669
Ensembl: ENSG00000173093
Vega: OTTHUMG00000169534
Pharos: Q8NA47(Tdark)
UniProt: Q8NA47
Position
12q24.11
AA seq 563 aa AA seqDB search
MSVLKKNRRKDSDTPQEPSEKAKEQQAEAELRKLRQQFRKMVESRKSFKFRNQQKIASQY
KEIKTLKTEQDEITLLLSLMKSSRNMNRSEKNYMELRLLLQTKEDYEALIKSLKVLLAEL
DEKILQMEKKIANQKQIFAKMQEANNPRKLQKQIHILETRLNLVTVHFDKMLTTNAKLRK
EIEDLRFEKAAYDNVYQQLQHCLLMEKKTMNLAIEQSSQAYEQRVEAMARMAAMKDRQKK
DTSQYNLEIRELERLYAHESKLKSFLLVKLNDRNEFEEQAKREEALKAKKHVKKNRGESF
ESYEVAHLRLLKLAESGNLNQLIEDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDE
IILLRSQQKLSHDDNHSVLRQLEDKLRKTTEEADMYESKYGEVSKTLDLLKNSVEKLFKK
INCDATKILVQLGETGKVTDINLPQYFAIIEKKTNDLLLLETYRRILEVEGAEAEIPPPF
INPFWGGSALLKPPEPIKVIPPVLGADPFSDRLDDVEQPLDHSSLRQLVLDNYILKENRS
KEVRGDSLPEKVDDFRSRKKVTM
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgttgaagaagaacaggagaaaagactccgacactccccaggaaccttcggag
aaggccaaagagcagcaggcggaggcagagctccggaagctaaggcagcagttcaggaag
atggtggaaagccggaagtcttttaagttccgaaaccagcagaagattgcgagtcagtac
aaggagatcaagaccctgaagacagagcaggatgagatcaccctactgttgagtctcatg
aaatcctcgaggaacatgaatcggagtgagaagaactacatggagctgcgactcctgctc
caaactaaggaggactatgaggcattgattaaatccctgaaagtgctgttggctgaactg
gatgagaagattcttcagatggaaaaaaaaatcgcaaaccaaaaacagattttcgcaaaa
atgcaggaggccaataacccccggaaactgcagaaacagattcacattttggaaacccgt
ttgaatctcgtcactgttcactttgacaagatgctgaccactaatgccaagctccggaag
gagattgaagacctacgatttgagaaggctgcttatgacaatgtctaccagcagctccag
cactgcctgttgatggagaagaaaaccatgaacttggccattgagcaatcttctcaggcc
tatgagcagagggtggaggccatggctcgaatggctgccatgaaagaccgccagaagaag
gacacctctcagtacaacctggagatccgagagctggagcgtctctatgcccatgagagc
aagctcaagtccttcctgctcgtcaagctgaatgatcgcaatgaattcgaggagcaggcc
aaaagggaggaagctctcaaggcaaagaagcatgtcaagaagaacaggggagagagtttt
gagagctatgaggtggcccacctccggctgctgaagctggctgagagtgggaacctaaac
cagctcattgaagattttctggccaaggaggagaagaattttgctcggttcacgtatgtc
acggagctcaacaacgacatggagatgatgcacaagaggacccaacgaatccaggacgag
atcatcctcttgcgatcccagcagaaattgtcccacgatgacaaccactctgtcctgaga
cagctggaggataaactgaggaagaccacggaggaggcagatatgtatgagagcaagtac
ggggaggtcagcaagaccttggatctattgaagaactcagtggagaaactgttcaagaag
ataaactgtgacgccaccaagatcctggtgcagttaggggagacggggaaagtcactgac
atcaaccttccgcagtattttgccatcattgaaaagaagaccaacgacctgctgctgttg
gagacctacaggcgcatcctggaagtggaaggggcagaggctgagatcccgccacccttc
atcaaccctttctggggtggctctgccctcctcaagcccccagaacccatcaaagtcatc
cccccagtgctgggggctgaccccttcagcgacaggttggatgatgtggaacagcccctg
gaccacagcagccttcggcagctggttctcgacaattatatcctgaaggagaatcggagt
aaggaagtgcgcggagacagcctgcctgagaaggtggatgacttcagatccaggaagaaa
gtaaccatgtga

DBGET integrated database retrieval system