KEGG   Homo sapiens (human): 160851Help
Entry
160851            CDS       T01001                                 

Gene name
DGKH, DGKeta
Definition
(RefSeq) diacylglycerol kinase eta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    160851 (DGKH)
   00564 Glycerophospholipid metabolism
    160851 (DGKH)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    160851 (DGKH)
   04072 Phospholipase D signaling pathway
    160851 (DGKH)
 09160 Human Diseases
  09161 Cancers
   05231 Choline metabolism in cancer
    160851 (DGKH)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     160851 (DGKH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAGK_cat SAM_2 C1_1 PH SAM_1 PH_8 C1_2 PH_11 Mcp5_PH SAM_PNT
Motif
Other DBs
NCBI-GeneID: 160851
NCBI-ProteinID: NP_821077
OMIM: 604071
HGNC: 2854
Ensembl: ENSG00000102780
Vega: OTTHUMG00000016804
Pharos: Q86XP1(Tbio)
UniProt: Q86XP1
Position
13q14.11
AA seq 1220 aa AA seqDB search
MAGAGGQHHPPGAAGGAAAGAGAAVTSAAASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQ
IRTKTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEAST
KNANNSFTIITPFRRLMLCAENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYA
CSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIED
EDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYHPICPL
GQCKVSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPA
QVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGTG
NDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPGPPEAS
EEFYMTIYEDSVATHLTKILNSDEHAVVISSAKTLCETVKDFVAKVEKTYDKTLENAVVA
DAVASKCSVLNEKLEQLLQALHTDSQAAPVLPGLSPLIVEEDAVESSSEESLGESKEQLG
DDVTKPSSQKAVKPREIMLRANSLKKAVRQVIEEAGKVMDDPTVHPCEPANQSSDYDSTE
TDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQTDSVPGPAVAASKENLPVLNTRII
CPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDLDSVDGYSEKCVMNNYFGIGLD
AKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLP
SLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKLQH
HRIAQCRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWE
DKQKCDSGKPVLRTHLYIHHAIDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQEL
AHAVNACSHALNKANPRCPESLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEER
VSNALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVQK
QKTSSQPVQKWGTEEVAAWLDLLNLGEYKDIFIRHDIRGAELLHLERRDLKDLGIPKVGH
VKRILQGIKELGRSTPQSEV
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggccggaggccagcaccaccctccgggcgccgctggaggagcggccgccgga
gccggcgccgcggtcacctccgccgctgcctcggcggggccgggagaggattcgtctgac
agcgaagcggagcaagagggaccccagaaactgatccgcaaagtgtctacctcggggcag
atccggaccaagaccagtattaaagagggacagctattgaagcaaaccagttctttccaa
aggtggaaaaagcgatacttcaaacttcgaggccgcaccctttactatgcaaaggactca
aagtctctgatatttgatgaagttgacctctcagatgctagtgtagctgaagcaagcacg
aaaaatgctaacaacagcttcacgatcatcactccattcagaaggctaatgctgtgtgct
gagaacagaaaggagatggaggattggatcagctcactgaagtctgtacagaccagagaa
ccctacgaggtggcccagtttaatgtggaacatttctcagggatgcacaactggtacgcc
tgctcccacgcccgacccaccttctgtaacgtgtgcagagagagtctttctggagtcacc
tcccatggcctgtcctgcgaagtgtgtaaattcaaggctcacaaaagatgtgcagtgaga
gcaacaaataactgtaaatggactaccctggcctccatcgggaaggacattatagaagat
gaagatggcgtcgcgatgcctcaccagtggcttgagggcaacctgcctgtaagtgccaag
tgtgctgtctgcgacaaaacatgtggcagtgttctccgtctacaggattggaaatgcctt
tggtgtaagacaatggtacacactgcctgcaaagatttataccatccaatatgtccactt
ggtcaatgtaaagtatctatcatacctccaattgcactaaacagcaccgattccgatggt
ttctgtagagcaacattttcgttctgtgttagtcctctattggtttttgtcaattctaag
agtggagataatcagggagtaaagttcctccgtcgctttaaacagttgctaaatccggct
caggtgtttgatttaatgaatggaggtcctcatttaggtttaagattatttcagaagttt
gacaatttccggattcttgtttgtggaggcgatggaagtgtaggttgggttttgtcagaa
atcgataagctcaacttgaataaacagtgtcagctgggagtgttgcctttgggtacagga
aatgaccttgcccgagttcttggctggggaggttcatatgacgatgacacccaacttcct
cagatcctagagaaactggaacgagccagtaccaaaatgttggacaggtggagtataatg
acatatgaactcaaattgccaccaaaagcttccctacttccaggacctccagaagcatct
gaagaattttatatgacgatttatgaagactcagttgcaacgcatcttacaaaaatcctc
aattctgatgaacatgcagtggtcatatcttctgccaagacgctatgtgaaactgtaaag
gacttcgttgccaaagtagaaaagacgtatgacaaaaccttggaaaatgccgttgtagct
gatgccgtggccagtaaatgttcagtcctaaacgagaagctcgaacaactgctgcaggct
ttgcacacagattcccaggctgcgcctgttctccctggcctcagccctctcattgtggaa
gaagatgctgtggaatcgtccagtgaagagtccctgggtgaaagcaaagagcagcttggg
gatgacgttacaaaaccttcctcccagaaagccgtcaaaccaagggaaatcatgttgcgg
gcaaatagtttaaagaaagcagtgaggcaagtcattgaggaagccggaaaagttatggat
gacccgacagttcacccctgtgaaccagctaatcagtcctctgattatgacagcacagaa
acagatgaatctaaggaggaagctaaagatgatggtgccaaagaatcaataactgttaaa
actgcacctcggtctccagatgcccgggcaagttatggccattcccaaactgattctgtc
cctggtccagctgtggcagccagcaaagaaaacctccctgtgctcaataccagaataatc
tgcccaggtttaagagcaggactggctgcctcaattgctgggagttcgattatcaacaaa
atgttactggcaaacattgatccttttggtgccacgccgtttattgacccggatctagat
tccgtagatggatattcagaaaaatgtgtcatgaacaattactttgggattggattagat
gcaaaaatttcattagaatttaataataaaagagaggagcaccctgaaaaatgcaggagc
cgaactaaaaacttgatgtggtatggagtccttggaacccgggagttattacagagatcg
tacaagaatttagaacaaagggttcaacttgagtgtgatgggcagtatattcctcttccc
agcttgcaaggcatagccgtgttgaacattcccagctatgctggaggcactaacttttgg
ggtggaactaaagaggatgatatatttgctgcaccatcctttgatgacaagatcctggaa
gttgtagcaatatttgatagcatgcaaatggcagtttcaagggtcattaaactgcagcat
catcgaatagcccagtgccgtacagtgaaaatcactatatttggtgacgaaggagtccca
gtgcaagtggatggtgaagcgtgggttcagcctccagggattatcaaaattgtgcacaaa
aacagagcacaaatgctaacaagggacagagcctttgagagcactctgaaatcttgggaa
gataagcagaagtgtgattctggtaaaccagttctccgaacccatttgtacatccatcac
gccattgacttggcaacagaagaggtgtcgcagatgcagctatgctcccaggctgcagag
gagctcattactaggatatgtgacgcagccacaattcactgtcttttggagcaagaactg
gcccatgctgtgaatgcctgctcccatgccctgaataaagccaacccaaggtgcccggag
agtcttacaagagacactgccactgaaatagccatcaatgtgaaggcgctgtataatgaa
acagaatctttgctagttggcagggttcctttgcagctggaatcgccacatgaagagcga
gtatccaatgccttacactctgtggaggtggaattacagaaactgacagagattccttgg
ctttattatatcttacacccaaatgaggatgaggaacctcctatggattgcaccaaaagg
aacaacagaagcaccgtatttcgaatagtgccaaagtttaaaaaggaaaaggttcagaag
cagaagacaagttcacagcctgttcagaaatggggcacagaggaagttgctgcttggctg
gatctgctcaatttgggagagtacaaagatatcttcatccgtcatgacatcagaggggct
gaacttttgcatctggaaaggcgagatcttaaggatctggggataccgaaagtgggtcat
gtgaagcgaattctccagggaattaaagagcttggaaggagcactccacagtcggaggtg
taa

DBGET integrated database retrieval system