KEGG   Homo sapiens (human): 160857Help
Entry
160857            CDS       T01001                                 

Gene name
CCDC122
Definition
(RefSeq) coiled-coil domain containing 122
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1664 Spc7 Lebercilin Cnn_1N T6PP_N FliD_C CENP-F_leu_zip TPR_MLP1_2 Myosin_tail_1 Filament Phage_GPO Golgin_A5 HMMR_N DUF3450 Cep57_MT_bd Fib_alpha ATG16 ADIP FPP
Motif
Other DBs
NCBI-GeneID: 160857
NCBI-ProteinID: NP_659411
OMIM: 613408
HGNC: 26478
Ensembl: ENSG00000151773
Vega: OTTHUMG00000017413
Pharos: Q5T0U0(Tdark)
UniProt: Q5T0U0
Position
13q14.11
AA seq 273 aa AA seqDB search
MSDNKERKSQGFPKEDNQDTSSLADAVEKVAKQQQSQASEIEKNKKVLFNLKNELHELEK
EIAAISAETKETERQIYQQDSAIENTKLHCDSLETQIKSLHSENVKLKFDIETAQEDFEE
HMIKYNAYYAKIKAHKNSLGEVESKWSFMTELHEKRDFVKKLKTMKEELMQDLQNPGGNR
ITQVQEDITNLKDKIITVKESIIEKTCFLEEEKKTHEKLRKEIEVQHKRYDAILKRLHCQ
VNKLQSNRRQWQWNIQQLEKTAAELRKCIGMQE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaacaaagaaaggaagagtcaaggatttcctaaagaagataaccaagacaca
agttcattagctgatgctgtagagaaagttgcaaagcaacaacaatcacaagcatcagag
atagaaaaaaacaaaaaggttctgttcaatttgaagaatgaacttcatgagcttgaaaaa
gaaatagcagctatctctgcagaaactaaagaaacagaaagacaaatttatcaacaagat
tctgccatagagaataccaaacttcattgtgatagcctggaaactcaaatcaaatcctta
cattcagaaaatgtaaagcttaaatttgacatagaaacagcccaagaagattttgaggaa
cacatgataaaatataatgcatattatgcaaaaataaaagcacataaaaatagtttgggg
gaagtagagagcaaatggtcatttatgactgaactccatgaaaagcgagattttgttaaa
aaattaaagacaatgaaagaagaacttatgcaagatcttcaaaatccaggagggaaccga
ataacacaagtacaggaagacattacaaacttaaaggataaaattataactgtaaaagaa
tctatcattgaaaaaacttgttttcttgaggaagaaaaaaagacacatgaaaaattaaga
aaagaaatagaggtacaacataagaggtatgatgcaattcttaagcgtttgcattgtcag
gtgaacaagcttcagtcaaatagacgacagtggcaatggaacattcaacaattggaaaaa
actgcagccgaattaagaaaatgcattggaatgcaagagtaa

DBGET integrated database retrieval system