KEGG   Homo sapiens (human): 160897Help
Entry
160897            CDS       T01001                                 

Gene name
GPR180, ITR
Definition
(RefSeq) G protein-coupled receptor 180
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GpcrRhopsn4 Lung_7-TM_R
Motif
Other DBs
NCBI-GeneID: 160897
NCBI-ProteinID: NP_851320
OMIM: 607787
HGNC: 28899
Ensembl: ENSG00000152749
Vega: OTTHUMG00000017207
Pharos: Q86V85(Tbio)
UniProt: Q86V85
Position
13q32.1
AA seq 440 aa AA seqDB search
MGGLRLLAVALTCCWWPQGSQGKTLRGSFSSTAAQDAQGQRIGHFEFHGDHALLCVRINN
IAVAVGKEAKLYLFQAQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQ
TWHVFYADKYTCQDDKENSQVEDIPFEMVLLNPDAEGNPFDHFSAGESGLHEFFFLLVLV
YFVIACIYAQSLWQAIKKGGPMHMILKVLTTALLLQAGSALANYIHFSSYSKDGIGVPFM
GSLAEFFDIASQIQMLYLLLSLCMGWTIVRMKKSQSRPLQWDSTPASTGIAVFIVMTQSV
LLLWEQFEDISHHSYHSHHNLAGILLIVLRICLALSLGCGLYQIITVERSTLKREFYITF
AKGCILWFLCHPVLACISVIFSDYQRDKVITIGVILCQSVSMVILYRLFLSHSLYWEVSS
LSSVTLPLTISSGHKSRPHF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgggggggctgcggctgctggctgtggccctcacgtgctgctggtggccgcagggcagc
cagggtaagaccctgcggggcagcttcagcagcaccgcggcccaggacgcccagggccag
cgcatcggccacttcgagttccatggtgaccatgctcttctgtgtgtcagaatcaacaac
atagcagtagctgttggaaaagaagctaaactctacctgttccaagcccaggaatggcta
aagctacagcaaagcagtcatggttatagctgtagtgaaaaattatccaaagctcagttg
acaatgaccatgaaccagaccgaacataatctgacagtgtcccagattccgtctccacaa
acgtggcatgtgttttatgcagacaagtatacatgccaagatgacaaggagaattctcag
gtggaagatatcccatttgaaatggtgttactaaacccagatgccgaagggaatccattt
gatcattttagtgctggagaatctgggttacatgagttctttttcctcctagtcctagtg
tactttgtgattgcttgcatttatgctcaatcattgtggcaggctattaagaaaggcgga
cccatgcacatgattttaaaggttctgacaactgcattgctgttacaagctggttcagct
ttagctaattacattcatttctccagttactccaaagatggaataggggtaccatttatg
ggaagtttggcagaattttttgacatcgcttcccaaattcagatgttatacttacttttg
agtctatgcatgggttggacaatagtcagaatgaagaagtctcaaagcagacctctccag
tgggattctacgcctgcatccactggcattgcagtattcattgtcatgacacagagtgtt
ttgctactttgggaacagtttgaagatatcagtcatcatagctaccattcacaccacaac
ttagcagggatcctcctaattgttctaagaatttgcctagcattgtcattaggctgtgga
ctctatcagatcatcacagtggagagaagtacactcaaaagggagttctacatcacattt
gccaaaggctgtatcttgtggtttttatgccatccagttcttgcatgcatttctgtcatt
tttagcgactaccaaagagacaaggttattacaataggtgttatcctttgccagtctgtt
tccatggttattctctacagactctttctgtctcacagtctatactgggaagtttcttca
ctttcttcagtaacactaccactgaccatatcatctggacacaaaagtcgccctcatttc
tga

DBGET integrated database retrieval system