KEGG   Homo sapiens (human): 161Help
Entry
161               CDS       T01001                                 

Gene name
AP2A2, ADTAB, CLAPA2, HIP-9, HIP9, HYPJ
Definition
(RefSeq) adaptor related protein complex 2 subunit alpha 2
  KO
K11824  AP-2 complex subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    161 (AP2A2)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    161 (AP2A2)
  Nervous system
   04721 Synaptic vesicle cycle
    161 (AP2A2)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    161 (AP2A2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    161 (AP2A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   161 (AP2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Cnd1 HEAT_2 DRIM RIX1
Motif
Other DBs
NCBI-GeneID: 161
NCBI-ProteinID: NP_036437
OMIM: 607242
HGNC: 562
Ensembl: ENSG00000183020
Vega: OTTHUMG00000165627
Pharos: O94973(Tbio)
UniProt: O94973
Position
11p15.5
AA seq 939 aa AA seqDB search
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMGLALHCIASVGSREMAEAFAGEIPKVLVAGDTMDSVKQSAALCLLRLYRTSP
DLVPMGDWTSRVVHLLNDQHLGVVTAATSLITTLAQKNPEEFKTSVSLAVSRLSRIVTSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPDPAVRGRLTECLETILNKAQEPPKSKKVQ
HSNAKNAVLFEAISLIIHHDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSEF
SHEAVKTHIETVINALKTERDVSVRQRAVDLLYAMCDRSNAPQIVAEMLSYLETADYSIR
EEIVLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVINRDDVQGYAAK
TVFEALQAPACHENLVKVGGYILGEFGNLIAGDPRSSPLIQFHLLHSKFHLCSVPTRALL
LSTYIKFVNLFPEVKPTIQDVLRSDSQLRNADVELQQRAVEYLRLSTVASTDILATVLEE
MPPFPERESSILAKLKKKKGPSTVTDLEDTKRDRSVDVNGGPEPAPASTSAVSTPSPSAD
LLGLGAAPPAPAGPPPSSGGSGLLVDVFSDSASVVAPLAPGSEDNFARFVCKNNGVLFEN
QLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICSDDLQPNLNLQTKPVDPTVEG
GAQVQQVVNIECVSDFTEAPVLNIQFRYGGTFQNVSVQLPITLNKFFQPTEMASQDFFQR
WKQLSNPQQEVQNIFKAKHPMDTEVTKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQ
IGCLLRLEPNLQAQMYRLTLRTSKEAVSQRLCELLSAQF
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgtgtccaagggggacgggatgcggggcctggcggtcttcatctcggatatc
cgcaactgtaaaagtaaagaagcagaaataaaaaggataaacaaggaactggcaaatatc
agatcaaaatttaaaggtgacaaggctcttgatggctatagtaaaaaaaagtacgtctgc
aagttgctcttcatctttctccttggtcatgacattgactttggacacatggaggctgtg
aacctgctgagttcaaacagatacacggaaaagcagatcggctaccttttcatctctgtg
ttggtgaactcaaacagtgagctgatccgcctgatcaacaacgccatcaagaatgacctg
gccagccgcaaccccaccttcatgggcctggccctgcactgcatcgccagcgtgggcagc
cgggagatggccgaggccttcgccggggagatccctaaggtcctcgtagccggagacact
atggacagcgtgaagcagagcgcggccctgtgcttgctgcgcctgtacaggacgtccccc
gatcttgtccccatgggcgactggacatcccgagtggtgcacctgctcaatgaccagcac
ttgggtgtggtaactgcagccacaagtctgatcaccactttagcacagaagaacccagaa
gagtttaaaacctccgtgtctctggctgtctctaggctaagcagaatcgtgacgtctgca
tccacagatctccaggattacacttactattttgtcccggctccctggctgtctgtcaaa
ctgctgagactgctgcagtgctacccacccccagaccctgcagtgcgaggccgcctgact
gagtgcctggagaccatcctgaacaaagcccaagaaccgcccaagtcgaagaaggtccag
cactccaacgcgaagaatgccgtgctcttcgaggccatcagcttaatcattcaccatgac
agtgagccgaacctgctcgtccgtgcctgcaaccagttgggccagtttctgcagcaccgc
gagaccaacctgcgctacctggccctggagagcatgtgcacgctggccagctctgagttc
tcccatgaggctgtcaagacgcacatcgagacggtcatcaacgccctgaagactgagcgg
gacgtgagcgtgcggcagcgggccgtggacctcctctacgccatgtgcgaccgcagcaac
gccccacagatcgtggccgagatgctgagctatctggagacagctgactactccatccga
gaagagattgtgctgaaggtcgccatcctggctgagaagtacgcggtggactacacctgg
tatgtggataccatcttgaacttgatccgaattgctggtgattacgtgagtgaagaggtg
tggtaccgagtcattcagatcgtcatcaaccgggacgacgtgcagggctacgcggccaag
actgtgttcgaggctcttcaggctcccgcgtgccacgagaacctggtcaaagtgggcggc
tacatcctgggggagtttggaaacttgatagctggagacccgagatccagcccgctgatc
cagttccacctgctgcactccaagttccacctgtgcagcgtccccacccgcgcgctgctc
ctgtccacctacatcaagttcgtgaacctcttcccggaggtgaagcccaccatccaggac
gtgctgcgcagcgacagccagctcaggaacgcagacgtggagctgcagcagcgtgctgtg
gagtacctgcggctcagcaccgtggccagcaccgacattctggcgaccgtgctggaggag
atgcccccattcccggagcgggagtcctccatcttggcaaagctcaagaagaagaagggc
cccagcacggtgacagacctggaggacaccaagcgggacaggagtgtggacgtgaacggg
ggtcctgagcctgccccagccagtaccagcgccgtgtctacgccttctccgtcggcagac
ctgctgggtctcggggctgccccccctgcccccgcgggccccccaccctcctccggcggc
agcgggctgctcgtggacgtgttctcagactcggcctctgtggtcgcgcctctcgctcct
ggctccgaagacaactttgccaggtttgtttgtaaaaacaatggtgtgttgtttgaaaac
cagctgcttcaaattggacttaagtctgaatttcggcagaatttaggtcggatgtttatc
ttttatggtaataagacctccacgcagttcctaaactttaccccaacactaatctgttca
gacgaccttcagcctaacctgaacctgcagaccaagcccgtggacccgaccgtggagggg
ggcgcgcaggtgcagcaggtggtcaacatagagtgcgtgtccgacttcacggaggcgcca
gtcctcaacattcagttcaggtatgggggcaccttccagaacgtgtctgtgcagctgccc
atcactctcaacaaattcttccagccgacagaaatggcttctcaggatttctttcaacgt
tggaagcagttgagcaatccacagcaggaagtgcagaacatcttcaaagcaaagcaccca
atggacacagaagtcaccaaagccaagatcattggatttggttctgcacttcttgaagaa
gttgatcctaatcctgcgaatttcgtgggagctggaatcatccacacgaaaaccacccag
attggatgcctgctgcgcttggagccgaacctgcaagcccagatgtaccggctcacgctg
cgcacaagtaaggaagccgtttctcagagattatgtgaattgctctcagcgcagttttag

DBGET integrated database retrieval system