KEGG   Homo sapiens (human): 1610Help
Entry
1610              CDS       T01001                                 

Gene name
DAO, DAAO, DAMOX, OXDA
Definition
(RefSeq) D-amino acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00330  Arginine and proline metabolism
hsa00472  D-Arginine and D-ornithine metabolism
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    1610 (DAO)
   00330 Arginine and proline metabolism
    1610 (DAO)
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    1610 (DAO)
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    1610 (DAO)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    1610 (DAO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     1610 (DAO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO Pyr_redox UDPG_MGDP_dh_N FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 1610
NCBI-ProteinID: NP_001908
OMIM: 124050
HGNC: 2671
Ensembl: ENSG00000110887
Vega: OTTHUMG00000169360
Pharos: P14920(Tchem)
UniProt: P14920 A0A024RBI1
Structure
PDB: 

Position
12q24.11
AA seq 347 aa AA seqDB search
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggtggtgattggagcaggagtcatcgggctgtccaccgccctctgcatccat
gagcgctaccactcagtcctgcagccactggacataaaggtctacgcggaccgcttcacc
ccactcaccaccaccgacgtggctgccggcctctggcagccctacctttctgaccccaac
aacccacaggaggcggactggagccaacagacctttgactatctcctgagccatgtccat
tctcccaacgctgaaaacctgggcctgttcctaatctcgggctacaacctcttccatgaa
gccattccggacccttcctggaaggacacagttctgggatttcggaagctgacccccaga
gagctggatatgttcccagattacggctatggctggttccacacaagcctaattctggag
ggaaagaactatctacagtggctgactgaaaggttaactgagaggggagtgaagttcttc
cagcggaaagtggagtcttttgaggaggtggcaagagaaggcgcagacgtgattgtcaac
tgcactggggtatgggctggggcgctacaacgagaccccctgctgcagccaggccggggg
cagatcatgaaggtggacgccccttggatgaagcacttcattctcacccatgacccagag
agaggcatctacaattccccgtacatcatcccagggacccagacagttactcttggaggc
atcttccagttgggaaactggagtgaactaaacaatatccaggaccacaacaccatttgg
gaaggctgctgcagactggagcccacactgaagaatgcaagaattattggtgaacgaact
ggcttccggccagtacgcccccagattcggctagaaagagaacagcttcgcactggacct
tcaaacacagaggtcatccacaactatggccatggaggctacgggctcaccatccactgg
ggatgtgccctggaggcagccaagctctttgggagaatcctggaagaaaagaaattgtcc
agaatgccaccatcccacctctga

DBGET integrated database retrieval system