KEGG   Homo sapiens (human): 161424
Entry
161424            CDS       T01001                                 
Symbol
NOP9, C14orf21, HP08474
Name
(RefSeq) NOP9 nucleolar protein
  KO
K14790  nucleolar protein 9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    161424 (NOP9)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    161424 (NOP9)
SSDB
Motif
Pfam: PUF_NOP9
Other DBs
NCBI-GeneID: 161424
NCBI-ProteinID: NP_777573
OMIM: 618308
HGNC: 19826
Ensembl: ENSG00000196943
UniProt: Q86U38
Position
14:24271203..24309124
AA seq 636 aa
MGQGPRSPHKVGRRFPAGGKRGRGAKGSGRPLPGRKRQPWPPPDGRSEPAPDSHPHLSPE
ALGYFRRALSALKEAPETGEERDLMVHNIMKEVETQALALSTNRTGSEMLQELLGFSPLK
PLCRVWAALRSNLRTVACHRCGVHVLQSALLQLPRLLGSAAEEEEEEEEDGKDGPTETLE
ELVLGLAAEVCDDFLVYCGDTHGSFVVRTLLQVLGGTILESERARPRGSQSSEAQKTPAQ
ECKPADFEVPETFLNRLQDLSSSFLKDIAVFITDKISSFCLQVALQVLHRKLPQFCAHLC
NAVIGYLSTRGSSVDGSPLLLFLRDQTSSRLLEQVLLVLEPPRLQSLFEEHLQGQLQTLA
AHPIANFPLQRLLDAVTTPELLSPVFEELSPVLEAVLAQGHPGVVIALVGACRRVGAYQA
KVLQLLLEAFHCAEPSSRQVACVPLFATLMAYEVYYGLTEEEGAVPAEHQVAMAAARALG
DVTVLGSLLLQHLLHFSTPGLVLRSLGALTGPQLLSLAQSPAGSHVLDAILTSPSVTRKL
RRRVLQNLKGQYVALACSRHGSRVLDAIWSGAALRARKEIAAELGEQNQELIRDPFGHHV
ARNVALTTFLKRREAWEQQQGAVAKRRRALNSILED
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggggcagggtccgcgctctccacacaaggtggggcgccggttcccagctggtggcaaa
cgggggcgcggggccaaggggtcggggcgccccttaccaggccgtaagcggcaaccctgg
ccgcctccggatgggcgctcggagccggctccagattcgcacccgcacctgagcccggaa
gctctgggatatttccgccgggcgctgtcagcattgaaagaggctcccgagactggggaa
gaacgagatctgatggtgcacaatataatgaaggaagtagagactcaggccctagctttg
tccacgaacaggactggcagtgagatgctgcaggaactgttgggattcagtcccttgaaa
ccgctttgtcgcgtgtgggctgctctgcgctctaacttgcgcactgtggcctgtcaccga
tgcggggtccatgtattacaaagtgctttgctacagctccctcgattgctggggagtgct
gcagaggaggaggaggaggaggaggaggatggaaaggatggtcccacggagaccctggag
gagctggtcctgggactagccgctgaggtgtgtgatgattttcttgtctactgtggagac
acacatggcagcttcgtggtcagaactctgcttcaggtgttaggagggactattctggag
tctgagagagccaggccccgtggttcccaatcatctgaagcacagaagaccccagctcag
gaatgtaagccagctgattttgaagtccctgaaacctttttgaatcgccttcaggacctg
agctcctcctttctgaaggacattgcagtgtttatcactgataagatctccagcttctgt
cttcaagtggctttacaggttttacaccgcaaacttccccagttttgcgctcatctctgc
aatgctgtgattggctacctgagtactcgcggttcctcagtagatggcagtcccctactg
ctatttctccgagatcagacgagttccagactcctggagcaggtcctgctggtgttggag
cccccaagactccagagcctctttgaggagcacttgcaggggcagctgcagaccctggct
gcacatcccattgccaacttccctttgcagcgcttactggatgcagtcactacccctgag
ctgctgtcccctgtgtttgaggagctgagccctgtcttggaagctgtattggcccagggc
cacccaggggtagtcattgccctggtgggggcctgtcgcagagttggggcctaccaagcc
aaggtcctacagctcttgttggaggcattccactgtgcagagccctcatcccggcaagtg
gcctgtgtgcctctctttgccactttgatggcttatgaggtgtactatggactgacggag
gaggagggggcagtgcctgcagagcaccaggtggcaatggccgcagccagagccttgggg
gatgtgacagtccttgggtctctactgctccagcatctgctgcacttctccactcctggt
cttgtacttcgaagtctgggtgccttgacgggaccacagcttctgtcccttgcccaaagt
cccgctggctctcatgtgctcgatgccatcctgaccagcccctctgtgacgcgcaagctg
cgccgccgtgtgctgcagaacctaaagggacaatatgtggctctggcctgtagtcgccat
ggcagccgtgtgctagatgccatctggagtggagcagccttgagggcccggaaggaaatt
gctgctgagcttggggagcagaaccaggagctgataagagaccctttcggccaccatgtg
gctcgaaatgtggccttgactaccttcctaaagcggcgagaggcttgggaacagcagcag
ggtgcggtggccaagcggaggcgggcattgaactccatacttgaagactga

DBGET integrated database retrieval system