KEGG   Homo sapiens (human): 1615
Entry
1615              CDS       T01001                                 
Symbol
DARS1, DARS, HBSL, aspRS
Name
(RefSeq) aspartyl-tRNA synthetase 1
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00970  Aminoacyl-tRNA biosynthesis
Disease
H02433  Hypomyelination with brainstem and spinal cord involvement and leg spasticity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    1615 (DARS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    1615 (DARS1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    1615 (DARS1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     1615 (DARS1)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   1615 (DARS1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    1615 (DARS1)
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d S-AdoMet_synt_N
Other DBs
NCBI-GeneID: 1615
NCBI-ProteinID: NP_001340
OMIM: 603084
HGNC: 2678
Ensembl: ENSG00000115866
Pharos: P14868(Tbio)
UniProt: P14868 A0A140VJW5
Structure
Position
2:complement(135905881..135985684)
AA seq 501 aa
MPSASASRKSQEKPREIMDAAEDYAKERYGISSMIQSQEKPDRVLVRVRDLTIQKADEVV
WVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVV
RKVNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRL
DNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYF
KNNAYLAQSPQLYKQMCICADFEKVFSIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYH
EVMEEIADTMVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGV
EMGDEDDLSTPNEKLLGHLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFM
RGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLF
LGLHNVRQTSMFPRDPKRLTP
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgcccagcgccagcgccagccgcaagagtcaggagaagccgcgggagatcatggacgcg
gcggaagattatgctaaagagagatatggaatatcttcaatgatacaatcacaagaaaaa
ccagatcgagttttggttcgggttagagacttgacaatacaaaaagctgatgaagttgtt
tgggtacgtgcaagagttcatacaagcagagctaaagggaaacagtgcttcttagtccta
cgtcagcagcagtttaatgtccaggctcttgtggcggtgggagaccatgcaagcaagcag
atggttaaatttgctgccaacatcaacaaagagagcattgtggatgtagaaggtgttgtg
agaaaagtgaatcagaaaattggaagctgtacacagcaagacgttgagttacatgttcag
aagatttatgtgatcagtttggctgaaccccgtctgcccctgcagctggatgatgctgtt
cggcctgaggcagaaggagaagaggaaggaagagctactgttaaccaggatacaagatta
gacaacagagtcattgatcttaggacatcaactagtcaggcagtcttccgtctccagtct
ggcatctgccatctcttccgagaaactttaattaacaaaggttttgtggaaatccaaact
cctaaaattatttcagctgccagtgaaggaggagccaatgtttttactgtgtcatatttt
aaaaataatgcatacctggctcagtccccacagctatataagcaaatgtgcatttgtgct
gattttgagaaggttttctctattggaccagtattcagagcggaagactctaatacccat
agacatctaactgagtttgttggtttggacattgaaatggcttttaattaccattaccac
gaagttatggaagaaattgctgacaccatggtacaaatattcaaaggacttcaagaaagg
tttcagactgaaattcaaacagtgaataaacagttcccatgtgagccattcaaatttttg
gagccaactctaagactagaatattgtgaagcattggctatgcttagggaagctggagtc
gaaatgggagatgaagacgatctgagcacaccaaatgaaaagctgttgggtcatttggta
aaggaaaagtatgatacagatttttatattcttgataaatatccattggctgtaagacct
ttctataccatgcctgacccaagaaatcccaaacagtccaactcttacgatatgttcatg
agaggagaagaaatattgtcaggagctcaaagaatacatgatcctcaactgctaacagag
agagctttacatcatggaattgatttggagaaaattaaggcttacattgattccttccgc
tttggagcccctcctcatgctggtggaggcattggattggaacgagttactatgctgttt
ctgggattgcataatgttcgtcagacctccatgttccctcgtgatcccaaacgactcact
ccttaa

DBGET integrated database retrieval system