KEGG   Homo sapiens (human): 1616Help
Entry
1616              CDS       T01001                                 

Gene name
DAXX, BING2, DAP6, EAP1
Definition
(RefSeq) death domain associated protein
  KO
K02308  death-associated protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04210  Apoptosis
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05168  Herpes simplex infection
Disease
H00045  Pancreatic neuroendocrine tumor
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1616 (DAXX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    1616 (DAXX)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    1616 (DAXX)
  09172 Infectious diseases: Viral
   05168 Herpes simplex infection
    1616 (DAXX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Daxx Nop14 DUF1510
Motif
Other DBs
NCBI-GeneID: 1616
NCBI-ProteinID: NP_001135441
OMIM: 603186
HGNC: 2681
Ensembl: ENSG00000204209
Vega: OTTHUMG00000031203
Pharos: Q9UER7(Tbio)
UniProt: Q9UER7 A0A024RCS3 Q53F85
Structure
PDB: 

Position
6p21.32
AA seq 740 aa AA seqDB search
MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYK
LENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRP
AKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPR
TRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLC
ELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARH
SLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARR
LRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPS
GMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEE
DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAP
SSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTV
LENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNG
KKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTC
KTSVATQCDPEEIIVLSDSD
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgctaacagcatcatcgtgctggatgatgatgacgaagatgaagcagctgct
cagccagggccctcccacccactccccaatgcggcctcacctggggcagaagcccctagc
tcctctgagcctcatggggccagaggaagcagtagttcgggcggcaagaaatgctacaag
ctggagaatgagaagctgttcgaagagttccttgaactttgtaagatgcagacagcagac
caccctgaggtggtcccattcctctataaccggcagcaacgtgcccactctctgtttttg
gcctcggcggagttctgcaacatcctctctagggtcctgtctcgggcccggagccggcca
gccaagctctatgtctacatcaatgagctctgcactgttctcaaggcccactcagccaaa
aagaagctgaacttggcccctgccgccaccacctccaatgagccctctgggaataaccct
cccacacacctctccttggaccccacaaatgctgaaaacactgcctctcagtctccaagg
acccgtggttcccggcggcagatccagcgtttggagcagctgctggcgctctatgtggca
gagatccggcggctgcaggaaaaggagttggatctctcagaattggatgacccagactcc
gcatacctgcaggaggcacggttgaagcgtaagctgatccgcctctttgggcgactatgt
gagctgaaagactgctcttcactgaccggccgtgtcatagagcagcgcatcccctaccgt
ggcacccgctacccagaggttaacaggcgcattgagcggctcatcaacaagccagggcct
gataccttccctgactatggggatgtgcttcgggctgtagagaaggcagctgcccgacac
agccttggcctcccccgacagcagctccagctcatggctcaggatgccttccgagatgtg
ggcatcaggttacaggagcgacgtcacctcgatctcatctacaactttggctgccacctc
acagatgactataggccaggcgttgaccctgcactatcagatcctgtgttggcccggcgc
cttcgggaaaaccggagtttggccatgagtcggctggatgaggtcatctccaaatatgca
atgttgcaagacaaaagtgaggagggcgagagaaaaaagagaagagctcggctccaaggc
acctcttcccactctgcagacacccccgaagcctccttggattctggtgagggccctagt
ggaatggcatcccaggggtgcccttctgcctccagagctgagacagatgacgaagacgat
gaggagagtgatgaggaagaggaggaggaggaggaagaagaagaggaggaggccacagat
tctgaagaggaggaggatctggaacagatgcaggagggtcaggaggatgatgaagaggag
gacgaagaggaagaagcagcagcaggtaaagatggagacaagagccccatgtcctcacta
cagatctccaatgaaaagaacctggaacctggcaaacagatcagcagatcttcaggggag
cagcaaaacaaaggacgcatagtgtcaccatcgttactgtcagaagaacccctggccccc
tccagcatagatgctgaaagcaatggagaacagcctgaggagctgaccctggaggaagaa
agccctgtgtctcagctctttgagctagagattgaagctttgcccctggataccccttcc
tctgtggagacggacatttcctcttccaggaagcaatcagaggagcccttcaccactgtc
ttagagaatggagcaggcatggtctcttctacttccttcaatggaggcgtctctcctcac
aactggggagattctggtcccccctgcaaaaaatctcggaaggagaagaagcaaacagga
tcagggccattaggaaacagctatgtggaaaggcaaaggtcagtgcatgagaagaatggg
aaaaagatatgtaccctgcccagcccaccttcccccttggcttccttggccccagttgct
gattcctccacgagggtggactctcccagccatggcctggtgaccagctccctctgcatc
ccttctccagcccggctgtcccaaaccccccattcacagcctcctcggcctggtacttgc
aagacaagtgtggccacacaatgcgatccagaagagatcatcgtgctctcagactctgat
tag

DBGET integrated database retrieval system