KEGG   Homo sapiens (human): 1617Help
Entry
1617              CDS       T01001                                 

Gene name
DAZ1, DAZ, SPGY
Definition
(RefSeq) deleted in azoospermia 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 RRM_7
Motif
Other DBs
NCBI-GeneID: 1617
NCBI-ProteinID: NP_004072
OMIM: 400003
HGNC: 2682
Ensembl: ENSG00000188120
Vega: OTTHUMG00000044053
Pharos: Q9NQZ3(Tbio)
UniProt: Q9NQZ3 A0A140VJH5
Position
Yq11.223
AA seq 744 aa AA seqDB search
MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCF
GRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC
ARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISR
EASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNR
TGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPP
PPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQSSSAAASQGW
VLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVND
VDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTET
YLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPV
YNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSS
PFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPV
YNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVG
EQRRNLWTEAYKWWYLVCLIQRRD
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgcaaatcctgagactccaaactcaaccatctccagagaggccagcacccag
tcttcatcagctgcagctagccaaggctgggtgttaccagaaggcaaaatcgtgccaaac
actgtttttgttggtggaattgatgctaggatggatgaaactgagattggaagctgcttt
ggtagatacggttcagtgaaagaagtgaagataatcacgaatcgaactggtgtgtccaaa
ggctatggatttgtttcgtttgttaatgacgtggatgtccagaagatagtaggatcacag
atacatttccatggtaaaaagctgaagctgggccctgcaatcaggaaacaaaagttatgt
gctcgtcatgtgcagccacgtcctttggtagttaatcctcctcctccaccacagtttcag
aacgtctggcggaatccaaacactgaaacctacctgcagccccaaatcacgccgaatcct
gtaactcagcacgttcagtctgctgcaaatcctgagactccaaactcaaccatctccaga
gaggccagcacccagtcttcatcagctgcagctagccaaggctgggtgttaccagaaggc
aaaatcgtgccaaacactgtttttgttggtggaattgatgctaggatggatgaaactgag
attggaagctgctttggtagatacggttcagtgaaagaagtgaagataatcacgaatcga
actggtgtgtccaaaggctatggatttgtttcgtttgttaatgacgtggatgtccagaag
atagtaggatcacagatacatttccatggtaaaaagctgaagctgggccctgcaatcagg
aaacaaaagttatgtgctcgtcatgtgcagccacgtcctttggtagttaatcctcctcct
ccaccacagtttcagaacgtctggcggaatccaaacactgaaacctacctgcagccccaa
atcacgccgaatcctgtaactcagcacgttcagtctgctgcaaatcctgagactccaaac
tcaaccatctccagagaggccagcacccagtcttcatcagctgcagctagccaaggctgg
gtgttaccagaaggcaaaatcgtgccaaacactgtttttgttggtggaattgatgctagg
atggatgaaactgagattggaagctgctttggtagatacggttcagtgaaagaagtgaag
ataatcacgaatcgaactggtgtgtccaaaggctatggatttgtttcgtttgttaatgac
gtggatgtccagaagatagtaggatcacagatacatttccatggtaaaaagctgaagctg
ggccctgcaatcaggaaacaaaagttatgtgctcgtcatgtgcagccacgtcctttggta
gttaatcctcctcctccaccacagtttcagaacgtctggcggaatccaaacactgaaacc
tacctgcagccccaaatcacgccgaatcctgtaactcagcacgttcaggcttactctgct
tatccacattcaccaggtcaggtcatcactggatgtcagttgcttgtatataattatcag
gaatatcctacttatcccgattcagcatttcaggtcaccactggatatcagttgcctgta
tataattatcagccatttcctgcttatccaagatcaccatttcaggtcactgctggatat
cagttgcctgtatataattatcaggcatttcctgcttatccaaattcaccatttcaagtc
gccactggatatcagttccctgtatacaattatcagccatttcctgcttatccaagttca
ccatttcaggtcactgctggatatcagttgcctgtatataattatcaggcatttcctgct
tatccaaattcaccatttcaagtcgccactggatatcagttccctgtatacaattatcag
gcatttcctgcttatccaaattcaccagttcaggtcaccactggatatcagttgcctgta
tacaattatcaggcatttcctgcttatccaagttcaccatttcaggtcaccactggatat
cagttgcctgtatataattatcaggcatttcctgcttatccaaattcagcagttcaggtc
accactggatatcagttccatgtatacaattaccagatgccaccgcagtgccctgttggg
gagcaaaggagaaatctgtggaccgaagcatacaaatggtggtatcttgtctgtttaatc
cagagaagagactga

DBGET integrated database retrieval system