KEGG   Homo sapiens (human): 161742
Entry
161742            CDS       T01001                                 

Gene name
SPRED1, LGSS, NFLS, PPP1R147, hSpred1, spred-1
Definition
(RefSeq) sprouty related EVH1 domain containing 1
  KO
K04703  sprouty-related, EVH1 domain-containing protein
Organism
hsa  Homo sapiens (human)
Disease
H01986  Legius syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    161742 (SPRED1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     161742 (SPRED1)
SSDB
Motif
Pfam: Sprouty WH1 SMC_ScpA
Other DBs
NCBI-GeneID: 161742
NCBI-ProteinID: NP_689807
OMIM: 609291
HGNC: 20249
Ensembl: ENSG00000166068
Vega: OTTHUMG00000172377
Pharos: Q7Z699(Tbio)
UniProt: Q7Z699
Structure
PDB: 
3SYX

Position
15q14
AA seq 444 aa
MSEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFI
RGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAI
EDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFED
LNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQ
DEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDET
KLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIK
RCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCY
VPLRMCHRCGEACGCCGGKHKAAG
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgagcgaggagacggcgacttctgacaacgataatagttatgcacgagtgcgagctgtg
gtgatgacccgagatgactcaagtggtggatggttaccacttggagggagtggactaagc
agcgtcactgtcttcaaagtccctcatcaggaagagaatggctgtgctgacttttttatc
cgtggagagcgactcagggacaaaatggtggttttggaatgtatgcttaaaaaagacctc
atttataataaggtcactccaacatttcaccactggaagattgatgacaagaagtttggt
cttacgtttcaaagtcctgctgatgctagggcttttgatagaggtatccgaagagctata
gaggatatttctcaaggatgccccgaatcaaaaaatgaagctgaaggggcagatgactta
caagcaaatgaagaggattcttccagttctctagtgaaggatcacctttttcagcaagag
acagttgttaccagtgagccttatagaagctcaaatataagaccttctccctttgaagat
ctgaatgccagaagagtctacatgcaaagccaagccaatcagataacatttggtcagcca
ggcttggacattcagagcagaagtatggaatacgtacagcggcaaatatccaaggaatgt
ggaagcctaaagtcccaaaatagggtccctttgaaatcaatcagacatgtcagctttcaa
gatgaggatgagattgtcagaataaaccctcgagatatcttaatacgtcgctatgcagac
tacagacatcctgacatgtggaaaaatgacttggaaagagatgatgctgattccagtatt
cagttttctaaaccagacagtaaaaaatcagactatctgtactcttgtggggatgagact
aagttaagttcacccaaagactctgtggtatttaagacgcagccttcctcattaaaaatt
aagaagtcaaaacgaagaaaagaggatggtgaacgttctcgctgcgtatactgccaggaa
aggtttaatcatgaagaaaatgttaggggaaaatgtcaggatgctccagaccctattaaa
agatgcatatatcaagttagttgcatgctctgtgcagagagcatgttgtatcattgtatg
tcagactcagagggagatttttctgatccctgttcgtgtgacactagcgacgacaagttc
tgcttgcgatggttagccctggtagctttgtctttcattgtaccatgtatgtgctgctac
gtccctttgagaatgtgccatcgctgtggtgaggcatgtggttgctgtggtgggaaacat
aaagctgctggatga

DBGET integrated database retrieval system