KEGG   Homo sapiens (human): 161753
Entry
161753            CDS       T01001                                 
Symbol
ODF3L1
Name
(RefSeq) outer dense fiber of sperm tails 3 like 1
  KO
K25636  outer dense fiber protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    161753 (ODF3L1)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   161753 (ODF3L1)
SSDB
Motif
Pfam: SHIPPO-rpt
Other DBs
NCBI-GeneID: 161753
NCBI-ProteinID: NP_787077
HGNC: 28735
Ensembl: ENSG00000182950
Pharos: Q8IXM7(Tdark)
UniProt: Q8IXM7
Position
15:75724041..75727688
AA seq 274 aa
MKLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSCTGYIDHDIS
MFKAPAYTLHSRHSEKRMVCHSSPGPCYLLDPKITRFGMSSCPQVPMEERISNLRLNPTL
ASCQYYFEKIHPPGERRAPQYTFGYRRPYRVMDLNPAPNQYQMPLLLGPNTPVSRAAPCY
SLASRDKNWFYKEDVAGGPGPTTYARPEPSIYQNRSPTYSMAKRFAYPLDLTPRPGPGSH
EVQQVTVHKPHIPAFTMGIKHSLHLCPLVIDIRD
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaaactgcccaaggggaccaggagctctgtgtactttgcacagcacccagaaaaggag
ccattgccctcaaggcaggaggtcaagcagacccctgtcatcatggccaagatcaaaggt
ccggggcccgccaagtacctccggccatcctgcacgggctacatagatcatgacatctcc
atgttcaaggcaccagcttataccctgcatagccggcactcagagaagcggatggtgtgc
cacagcagccctgggccttgctatctcttggatcccaaaataactcggtttggaatgtcc
agctgcccgcaggtccccatggaggagcgcatctccaacctgcgcctgaaccccaccctc
gcatcctgccagtactactttgagaagatccacccaccgggggaacgcagggctccccag
tacacgtttggctaccggcgcccatacagagtgatggacctcaacccggctcccaaccag
taccagatgccactcttgctggggcccaacacccctgtcagccgagctgctccctgctac
agtctggcctccagggacaagaactggttctacaaggaggatgtggcaggaggccctgga
cctaccacgtacgcccgacctgagccatccatctatcagaaccgcagccctacttacagc
atggccaagcgcttcgcctaccctctggacctcacgccacggcctggccccggctcccac
gaggtccagcaggtcactgtgcacaagccccacatccctgctttcaccatgggcatcaag
cactcactccacctgtgcccactggtcatcgacattcgtgactga

DBGET integrated database retrieval system