KEGG   Homo sapiens (human): 162Help
Entry
162               CDS       T01001                                 

Gene name
AP1B1, ADTB1, AP105A, BAM22, CLAPB2
Definition
(RefSeq) adaptor related protein complex 1 subunit beta 1
  KO
K12392  AP-1 complex subunit beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    162 (AP1B1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    162 (AP1B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    162 (AP1B1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    162 (AP1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Cnd1 B2-adapt-app_C HEAT_2 HEAT Alpha_adaptinC2 Cnd3 Arm RTP1_C1 CLASP_N Arm_2 Mo25 Sec7_N
Motif
Other DBs
NCBI-GeneID: 162
NCBI-ProteinID: NP_001118
OMIM: 600157
HGNC: 554
Ensembl: ENSG00000100280
Vega: OTTHUMG00000151109
Pharos: Q10567(Tbio)
UniProt: Q10567
Structure
PDB: 

Position
22q12.2
AA seq 949 aa AA seqDB search
MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANA
VAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLLKKLAPPLVTLLSAEPELQY
VALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRK
YPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEV
VLAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASS
ESAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNLDLGPPVSGPPLATSSVQMGAVDLLG
GGLDSLMGDEPEGIGGTNFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPK
AVWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQ
VHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGK
MDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSL
KLTNGIWVLAELRIQPGNPSCTDLELSLKCRAPEVSQHVYQAYETILKN
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgactgactcaaaatatttcaccacgaccaagaaaggggagatcttcgagctgaaggca
gagctcaacagtgacaagaaggagaagaagaaggaggcagtgaagaaagtgattgcatcg
atgaccgtgggcaaagatgtcagtgccctcttccccgatgtggtcaactgcatgcagacg
gacaacctggagctgaagaagctagtatacctctacttgatgaattacgccaagagtcag
cctgacatggccattatggccgtcaacacctttgtgaaggactgtgaggaccccaacccc
ctcatccgagccctggcagtgcggaccatgggctgcatccgcgttgacaagatcacagag
tacctgtgcgagccactccggaagtgcctgaaggacgaggatccatatgtgcgcaagaca
gcagctgtgtgcgtggccaagctccacgacatcaacgcccagctggtggaggaccagggc
ttcctggacacccttaaagacctcatctccgactctaaccccatggtggtggccaatgca
gtggcagcgctctcagaaattgccgagtctcaccccagcagcaacctgctcgatctgaac
ccacagtccatcaacaagctgctgacagccctcaatgagtgcaccgagtggggccagatc
ttcatcctggactgcctcgccaactatatgcccaaggacgaccgcgaggcccagagcatc
tgtgagcgggtcacccccaggctctcccatgccaactccgctgtggtgctctctgctgtg
aaggtgctgatgaagttcatggagatgttgtctaaggacttggactactacggcacactg
ctcaagaagctggccccacccctggtcacactgctgtcagccgagccagagctgcagtat
gtggccctgcgcaacatcaatctcatcgtgcagaaaaggcctgagatcctgaagcatgag
atgaaggtgttcttcgtgaagtacaacgaccctatctacgtgaagctggagaagctggac
atcatgatccgcctggcctctcaggccaacatcgcccaggtgttggcagagctgaaagag
tacgcaacagaagtggatgtggactttgtacggaaggctgtgcgtgctattggccgctgc
gccatcaaggtggagcaatctgcggagcgctgtgtgagcacgctgctcgacctcatccag
accaaggtcaactatgtggtccaggaggccatcgtggtcatcaaggacatcttccgcaag
taccccaacaagtatgagagtgtgattgccacactgtgtgagaatctggactccctggat
gagcctgaggcccgggctgccatgatctggattgtgggcgagtacgcggaacggatcgac
aacgcagatgagctgctggagagcttcctcgagggcttccatgacgagagcacacaggtc
cagctgcagctgctgacagccattgtgaaactctttctaaagaagccaacagagacccag
gagctggtgcagcaggtcctcagtttggccactcaggactcagataacccagacctgcgg
gaccgtggctacatctactggcgcctgctgtccacggacccggtggcagccaaggaggtg
gtgttggctgagaagccactcatctctgaagagacggacctcatcgagcccacactgtta
gacgagcttatctgctacatcggcacgctggcttccgtctaccataagcctcccagtgcc
tttgtggaggggggccggggcgtcgtgcacaagagcctgccacctcgcacggcctcgagt
gagagcgcagagagccctgagacagcccctactggagcacctcctggggagcagccagat
gtcatccccgcccagggcgacctgctgggtgacctcctcaacctggacctcggcccccca
gtgagcggcccacccctggccacctcctcggtgcagatgggagctgtggaccttcttggc
ggtggccttgacagcctgatgggggatgagcctgaagggattgggggcaccaacttcgtg
gcacctccaacagcagcagtaccagccaatcttggagcacccatcggcagtggcctgagt
gacctctttgacctgaccagtggcgtgggcaccctgtcaggatcatatgtggcccccaaa
gcagtctggctcccagccatgaaggctaaggggctggagatctcaggcaccttcacccgc
caggtgggctccatctccatggacctgcagctgaccaacaaggccttgcaggtcatgacc
gactttgccatccagttcaaccgcaacagctttggcctggcccccgccgcccccctccag
gtccacgcgccactcagccccaaccagacagtggagatctccctgcctctcagcacggtg
ggctcggtcatgaagatggagcctctgaacaacctccaggtggccgtgaagaacaacatc
gatgtcttctacttcagcaccttgtacccactgcacatcctctttgtggaggacgggaag
atggaccggcagatgttcctggccacatggaaggatattcccaatgagaatgaggcccag
ttccagatcagagactgccccctcaatgcagaggctgcgagcagcaagctgcagagcagc
aacatcttcactgtcgccaagaggaacgtggagggccaggacatgctctaccagtccctg
aagctgaccaacggcatctgggtgctggcggagctgcggatccagccgggcaaccccagc
tgcacggacttagagctgtccctgaagtgtcgagcaccagaggtgtcccagcacgtgtac
caggcctacgagaccatcctcaagaactga

DBGET integrated database retrieval system