KEGG   Homo sapiens (human): 162387
Entry
162387            CDS       T01001                                 
Symbol
MFSD6L
Name
(RefSeq) major facilitator superfamily domain containing 6 like
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: MFS_1_like MFS_1
Other DBs
NCBI-GeneID: 162387
NCBI-ProteinID: NP_689812
HGNC: 26656
Ensembl: ENSG00000185156
Pharos: Q8IWD5(Tdark)
UniProt: Q8IWD5
Position
17:complement(8797110..8799365)
AA seq 586 aa
MSANPRWDISRALGVAKLFHLVCGVREACVTPFLTLYLRQLGLAAPWVGTLMGTKHLIAA
FWAPVCAFLAKSYRKRRALLIGSLLGSVGASLLMVLVPPVDKNRVHFPCNGSSGLTSTDA
LPGVTLPVNITSAQESASSHPAKRTAEVEMPGFRNPPGESDRETFRDLHVYLAPSVEGAR
TTSQALLHPVTSGLKDHPWEVTFEVVKTALPLLPGGKGPGNPANLSGTKGKAWAFDLSLE
ALRRTFILSLGSVAFWELLTAPLEQVADDSLYEFLDFVDATDRYRSLWVWRLLGMSAGVC
GITALVGQLDCFLMTSGPRGVVHFYGYSVVSTLALLVSIAFPIPICQQWEPSYKRVKALS
IVGGDPHLILLASTTVLVGAIVSTVQNFLFWHMKDHGSGELVMGFSVALSLLGEILLHPF
KATLLRKLSRTGLVGLGLSCLAGQLLYYSFLWSWWSVLPIQILSAISNRALWWAVGASVE
DLATPRMERALSALFRGHFYGSGCSLGSFVGGFVVMRFSLAVLYQACCVALLLWLALLLS
IQRRLPRERKIKYSKLLSMEVSDTSDSEQGTEQDWLVKAMREEHSD
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgagtgccaacccccggtgggacatcagcagggcgctgggggtggccaagctcttccac
ctggtgtgcggggtgcgggaagcctgcgtgaccccgttcctgaccctttacctgaggcag
ctgggcttggccgcgccctgggtgggcaccctaatgggaaccaagcacctaatcgctgcc
ttctgggctcccgtctgtgccttcctggccaaaagctaccggaaaaggagagcgcttctg
atcggctccctgctcggctcggtgggggccagcctgctgatggtcctggtcccaccggta
gacaaaaatcgggtgcacttcccttgtaatggaagcagcggcctgaccagcacagacgca
ctcccgggggtcacgctacctgtgaacatcacctcggcccaagagtctgcctccagccac
ccagccaagaggactgcagaggtggaaatgcctggcttcagaaacccacctggtgaaagt
gaccgagaaactttccgtgatctgcacgtctacttagcgccctccgttgaaggagctagg
accacatcccaagctctcctccatcctgtcacttcggggctgaaagatcatccctgggaa
gttacttttgaggtggtcaagacagccctccccttgcttcctggggggaaagggcccggg
aatccagccaatttgtcagggaccaaggggaaagcctgggcttttgacctgtccttggag
gcgttgcggcggacttttatcctctccttggggtccgtggcgttctgggagctgctgaca
gcgcctctggagcaggtggcagatgacagcctttatgagttcctggattttgtggatgcc
actgaccgatacagaagcctgtgggtctggaggttgctgggcatgtcggcaggcgtgtgt
ggcatcacagccttggtggggcagctggactgcttcctgatgaccagtggcccccgaggt
gtggtccacttctatgggtactcggtggtcagcaccctggccttactggtgagcattgcc
tttcccattcccatctgtcagcagtgggagcccagctacaaaagggtcaaagcactgtcc
attgtggggggtgacccccacctcattctcctcgcctccaccactgttttggtaggagcc
atcgtcagtactgtccagaactttctgttctggcacatgaaggaccatgggagcggcgag
ctggtcatgggtttctcggtcgccctcagcttgctgggggaaattctgcttcatccgttc
aaagctacattgcttaggaaactgtccaggacgggcctggtggggctggggctgagctgc
ctcgctgggcagctgctgtactactctttcctctggagctggtggtccgtcctccccatt
cagatcttgagtgccattagcaacagagctttgtggtgggctgtgggggcctcagtagag
gacctggccactccccgcatggagagggctctgagtgccttgttccgaggccacttttac
gggagtggctgtagcctgggcagctttgtcgggggcttcgtggtgatgcgcttcagcctg
gctgtgctctaccaggcctgctgtgtggccctgttgctctggttggccttgctcctgtcc
atacagcggaggctgccccgagagcggaaaatcaagtactcgaagctgctgtccatggag
gtgagtgacaccagtgactctgagcaggggacagaacaggactggcttgtgaaggccatg
agggaggaacactcagactga

DBGET integrated database retrieval system