KEGG   Homo sapiens (human): 162681
Entry
162681            CDS       T01001                                 
Symbol
C18orf54, LAS2
Name
(RefSeq) chromosome 18 open reading frame 54
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: LAS2
Other DBs
NCBI-GeneID: 162681
NCBI-ProteinID: NP_775800
OMIM: 613258
HGNC: 13796
Ensembl: ENSG00000166845
Pharos: Q8IYD9(Tdark)
UniProt: Q8IYD9 I7GY12
Position
18:54357906..54382035
AA seq 372 aa
MAKSKTKHRLCSQESSVSALLASCTLSGSNSSNSDGSFHYKDKLYRSASQALQAYIDDFD
LGQIYPGASTGKINIDEDFTNMSQFCNYIYKPNNAFENLDHKKHSNFISCRRHTVNDIDS
MSLTTDDLLRLPADGSFSYTYVGPSHRTSKKNKKCRGRLGSLDIEKNPHFQGPYTSMGKD
NFVTPVIRSNINGKQCGDKIELLILKAKRNLEQCTEELPKSMKKDDSPCSLDKLEADRSW
ENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLNNDNQSCTLSGGKHHGPVEALKQM
LFNLQAVQERFNQNKTTDPKEEIKQVSEDDFSKLQLKESMIPITRSLQKALHHLSRLRDL
VDDTNGERSPKM
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggcgaaatcaaagacaaaacatagactttgttctcaggaatcttcagtatctgccctg
ctggcaagctgcaccctgagtggtagtaattcctctaattctgatggctcgtttcactat
aaagataagctgtacagatctgcttctcaagctctacaggcttatattgatgattttgat
ctaggccaaatatatcctggtgcaagcactggaaaaattaacattgatgaggattttact
aatatgtcacagttctgcaactatatttacaaaccaaacaatgcttttgaaaaccttgat
cacaaaaagcactcaaacttcatatcctgtagaagacacaccgttaatgacatagactcc
atgagcctaacaactgatgatctattaagactcccagcagatggatcattttcttatact
tatgttggaccgagtcaccgaacgagcaagaaaaacaagaaatgccgtggaagactgggt
tcattggacattgagaagaatccacattttcaaggaccctacacttccatgggcaaggat
aactttgttactcctgttatacgctcaaatataaatggaaagcaatgtggtgacaaaatt
gaattgcttatcttgaaggccaagagaaatctagagcagtgtactgaagaattaccaaag
tccatgaaaaaggatgacagtccttgctcattagataaacttgaagcagacagatcatgg
gaaaatattcctgttactttcaaatctcctgttcccgttaactctgatgatagtcctcaa
caaacttcaagggcaaagagtgctaaaggggttcttgaagactttctaaataatgataat
cagagctgtactctctctggaggcaaacatcatggtcctgttgaagccctgaaacaaatg
ttatttaaccttcaagcagtacaagaacgttttaatcaaaataagaccacagatccaaaa
gaagagattaaacaagtttcagaagatgatttctctaaattacagttgaaggaaagtatg
attcctattactaggtcacttcagaaggctttgcaccatttatctcgcctgagagacctg
gttgatgatacgaatggagaacggtcaccgaaaatgtga

DBGET integrated database retrieval system