KEGG   Homo sapiens (human): 162962Help
Entry
162962            CDS       T01001                                 

Gene name
ZNF836
Definition
(RefSeq) zinc finger protein 836
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    162962 (ZNF836)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    162962 (ZNF836)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    162962 (ZNF836)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 zf-C2H2_11 zf-C2H2_jaz GAGA zinc_ribbon_15 XPA_N zf_UBZ ADK_lid zf-met HalOD2 DUF3268
Motif
Other DBs
NCBI-GeneID: 162962
NCBI-ProteinID: NP_001096127
HGNC: 34333
Ensembl: ENSG00000196267
Vega: OTTHUMG00000182567
Pharos: Q6ZNA1(Tdark)
UniProt: Q6ZNA1
Position
19q13.41
AA seq 936 aa AA seqDB search
MALTQGPLTFRDVAIEFSQEEWKSLDPVQKALYWDVMLENYRNLVFLGILPKCMTKELPP
IGNSNTGEKCQTVTLERHECYDVENFYLREIQKNLQDLEFQWKDGEINYKEVPMTYKNNL
NGKRGQHSQEDVENKCIENQLTLSFQSRLTELQKFQTEGKIYECNQSEKTVNNSSLVSPL
QRILPSVQTNISKKYENEFLQLSLPTQLEKTHIREKPYMCKGCGKAFRVSSSLINHQMVH
TTEKPYKCNECGKAFHRGSLLTIHQIVHTRGKPYQCGVCGKIFRQNSDLVNHRRSHTGEK
PYKCNECGKSFSQSYNLAIHQRIHTGEKPYKCNECGKTFKQGSCLTTHQIIHTGEKPYQC
DICGKVFRQNSNLVNHQRIHTGEKPYKCNICGKSFSQSSNLATHQTVHSGNKPYKCDECG
KTFKRSSSLTTHQIIHTGEKPYTCDVCDKVFSQRSQLARHQRSHTGEKPYKCNECGKVFS
QTSHLVGHRRIHTGEKPYKCDKCGKAFKQGSLLTRHKIIHTREKRYQCGECGKVFSENSC
LVRHLRIHTGEQPYKCNVCGKVFNYSGNLSIHKRIHTGEKPFQCNECGTVFRNYSCLARH
LRIHTGQKPYKCNVCGKVFNDSGNLSNHKRIHTGEKPFQCNECGKVFSYYSCLARHRKIH
TGEKPYKCNDCGKAYTQRSSLTKHLIIHTGEKPYNCNEFGGAFIQSSKLARYHRNPTGEK
PHKCSHCGRTFSHITGLTYHQRRHTGEMPYKCIECGQVFNSTSNLARHRRIHTGEKPYKC
NECGKVFRHQSTLARHRSIHTGEKPYVCNECGKAFRVRSILVNHQKMHTGDKPYKCNECG
KAFIERSKLVYHQRNHTGEKPYKCIECGKAFGRFSCLNKHQMIHSGEKPYKCNECGKSFI
SRSGLTKHQTKHTAESLKTKFNVEKPLDVLLTSGFK
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggctcttacacagggacctttgacattcagggatgtagccatagaattctctcaggag
gagtggaaatccctggaccctgtgcagaaagctttgtactgggatgtgatgttggagaac
tacaggaacctggtcttcctgggtatccttcctaaatgtatgaccaaggaattaccacca
atagggaacagtaatacaggagaaaaatgccaaacagtgacgctggaaagacatgaatgt
tatgatgttgaaaatttttacttaagggaaatccagaaaaatctacaggaccttgagttt
caatggaaagatggtgaaataaattataaagaagtgccaatgacctataaaaacaatctt
aatggtaaaagaggtcaacatagtcaagaggatgtagaaaacaaatgtattgaaaatcag
cttacattaagctttcagtcacgtctgactgaactgcagaaatttcaaactgaagggaaa
atttatgagtgtaaccaatctgagaagacagttaataacagttccctagtttcaccactt
caaagaattcttcctagtgtccaaaccaacatttctaaaaaatatgagaatgagtttttg
cagctgtcattacccacccaacttgagaaaacacacattagggaaaaaccttatatgtgt
aaagggtgtggcaaagcctttagagtgtcttcaagtcttattaaccatcagatggtacat
actacagagaaaccttacaaatgcaatgaatgtggcaaagcctttcatcggggctcacta
ctaactatacatcagatagtccatacaagggggaagccatatcaatgtggtgtatgtggc
aagatcttcagacaaaattcagatcttgtaaatcaccggagaagtcacactggagagaaa
ccgtacaaatgtaatgaatgtggcaagtcctttagtcaaagttataaccttgcaatacat
cagagaattcacactggagagaaaccttacaaatgtaatgagtgtgggaaaaccttcaaa
caaggctcatgcctcactacacatcagataatccatacaggagagaaaccatatcaatgt
gatatatgtggcaaggtcttcaggcagaattctaatcttgtaaatcaccagagaatccac
actggagagaaaccatacaaatgcaacatatgtggaaagtcctttagtcaaagttccaac
ctggcaactcatcagacagttcatagtggaaacaaaccttacaaatgtgatgagtgtggc
aaaacctttaaacggagctccagcctcactacacatcagataatccatacaggagagaaa
ccatatacatgtgatgtatgcgacaaggtcttcagtcaacgttcacaacttgcaaggcac
cagagaagtcatactggagagaaaccttacaaatgcaatgaatgtggcaaggtcttcagt
cagacttcacatcttgtggggcatcggagaattcatactggagagaaaccttacaaatgt
gataaatgtggtaaagcctttaaacagggctcattactcactcgacataagataattcat
accagagagaaacgttaccaatgcggtgaatgtggaaaggtctttagtgaaaattcatgc
cttgtaagacatttaagaattcatactggggagcaaccttacaaatgtaatgtgtgtggc
aaggtcttcaattacagtggaaacctttcaattcataagagaatacatacgggagagaaa
cctttccaatgtaatgaatgtggcacagtcttcaggaactactcatgcctagcacgtcat
ctaagaattcatactgggcagaaaccttacaaatgtaatgtgtgtggcaaggtcttcaat
gacagtggaaacctttcaaatcataagagaattcatactggagagaagccgtttcaatgt
aacgaatgcggcaaggttttcagttactactcatgcctagcacgtcatcggaaaattcat
accggagagaaaccttacaaatgtaatgattgtggcaaagcctatactcagcgttcaagc
ctcactaaacatctgataattcatactggagagaaaccttacaattgtaatgagtttgga
ggggcatttatccaaagttcaaaacttgcaagatatcacagaaatcctactggggagaaa
ccacacaaatgtagccattgtggtagaacttttagtcatataacaggcctgacgtaccat
cagagaaggcatactggagagatgccatacaaatgtattgaatgtggccaggtctttaat
tccacttcgaaccttgcaaggcatcggagaattcacactggagagaaaccttacaaatgt
aatgaatgtggcaaggtctttcgtcatcaatcaacactagcacgtcatcggagtattcat
actggagagaaaccttacgtgtgtaatgagtgtggcaaagcctttagagtgcgttcaatt
ctggttaatcatcagaaaatgcatactggggacaaaccttacaaatgtaatgaatgtggt
aaagcttttattgaaaggtcaaagctggtgtaccatcaaagaaatcacactggagagaag
ccatacaaatgtattgaatgtggcaaggcctttgggcggttttcttgcctcaacaaacac
caaatgattcattctggagaaaaaccttataaatgtaatgagtgtggcaaatctttcatt
agtcgctcaggcctcactaaacatcagacaaaacatactgcagagagtcttaaaacaaaa
ttcaatgtggaaaagcctttagatgttctcctaacttctgggttcaaataa

DBGET integrated database retrieval system