KEGG   Homo sapiens (human): 162979
Entry
162979            CDS       T01001                                 
Symbol
ZNF296, ZFP296, ZNF342
Name
(RefSeq) zinc finger protein 296
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-C2H2_9 zf-met DUF3268 zf-C2H2_11 zf-C2H2_7 zf-Di19
Other DBs
NCBI-GeneID: 162979
NCBI-ProteinID: NP_660331
OMIM: 613226
HGNC: 15981
Ensembl: ENSG00000170684
UniProt: Q8WUU4
Position
19:complement(45071500..45076478)
AA seq 475 aa
MSRRKAGSAPRRVEPAPAANPDDEMEMQDLVIELKPEPDAQPQQAPRLGPFSPKEVSSAG
RFGGEPHHSPGPMPAGAALLALGPRNPWTLWTPLTPNYPDRQPWTDKHPDLLTCGRCLQT
FPLEAITAFMDHKKLGCQLFRGPSRGQGSEREELKALSCLRCGKQFTVAWKLLRHAQWDH
GLSIYQTESEAPEAPLLGLAEVAAAVSAVVGPAAEAKSPRASGSGLTRRSPTCPVCKKTL
SSFSNLKVHMRSHTGERPYACDQCPYACAQSSKLNRHKKTHRQVPPQSPLMADTSQEQAS
AAPPEPAVHAAAPTSTLPCSGGEGAGAAATAGVQEPGAPGSGAQAGPGGDTWGAITTEQR
TDPANSQKASPKKMPKSGGKSRGPGGSCEFCGKHFTNSSNLTVHRRSHTGERPYTCEFCN
YACAQSSKLNRHRRMHGMTPGSTRFECPHCHVPFGLRATLDKHLRQKHPEAAGEA
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgtcccgccgcaaggccggcagcgcgccccgccgagtagagcccgcgcccgccgccaac
ccagacgacgagatggaaatgcaggacctcgtcatcgaactcaagcccgagccagacgcg
cagccccaacaggccccaaggctggggcccttctccccgaaggaggtgtcctcggcgggg
cggttcggcggcgaaccccaccactcccctggccccatgcccgccggggccgccctcctc
gccctcggcccgcggaacccgtggaccctgtggacgccgttgaccccgaactatcccgac
cgccagccctggaccgacaaacacccagatctgttgacctgcggccgctgcctgcagacc
ttcccgttggaggccatcactgccttcatggaccacaagaagctgggctgtcagctcttc
agaggccccagccgcggccagggctcagaacgagaggagctgaaggccttgagctgcctg
cgctgtggcaaacagttcacagtggcctggaagctgctgcgtcacgcccagtgggaccac
ggactgtccatctaccagacagaatcagaggccccggaggccccgctcctgggcctggcc
gaggtggctgcagccgtgtcggcagtggtggggccagcagctgaggccaagagcccccgt
gcaagtggcagcggcctcacccggcggagccccacctgtcctgtgtgcaagaagaccctc
agctccttcagcaacctcaaagtgcacatgcgctcacacacaggcgagcggccctatgct
tgcgaccagtgtccctacgcctgcgcccagagcagcaagctcaaccgccacaagaagacc
caccggcaggtgccgccccagagccccctcatggccgacaccagccaggagcaggcctct
gcagcccctccggagccggctgtccatgctgctgcccccaccagcacccttccatgcagc
ggtggtgagggggctggagccgccgccacagcaggtgtccaggaacccggggctcctggc
agtggggctcaagccggccctggtggagacacttggggagccatcaccacggaacaaaga
actgaccctgcaaacagccagaaggcatcacccaaaaagatgcccaagtcagggggcaag
agccgcgggcccgggggcagctgtgagttctgcgggaagcattttaccaacagcagcaac
ctgacggtgcaccggcgctcacacaccggggagcgcccctacacctgtgagttctgcaac
tacgcctgcgcccagagcagtaagctcaaccgccaccgccgcatgcacggcatgacgcct
ggcagcacccgcttcgagtgcccccactgccatgtgcccttcggcctgcgagccaccctg
gacaaacacctgcggcagaagcaccctgaggcggccggcgaggcctga

DBGET integrated database retrieval system