KEGG   Homo sapiens (human): 162998
Entry
162998            CDS       T01001                                 
Symbol
OR7D2, HTPCRH03, OR19-10, OR19-4
Name
(RefSeq) olfactory receptor family 7 subfamily D member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    162998 (OR7D2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    162998 (OR7D2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    162998 (OR7D2)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 162998
NCBI-ProteinID: NP_787079
HGNC: 8378
Ensembl: ENSG00000188000
Pharos: Q96RA2(Tdark)
UniProt: Q96RA2
Position
19:9178979..9188818
AA seq 312 aa
MEAGNQTGFLEFILLGLSEDPELQPFIFGLFLSMYLVTVLGNLLIILAISSDSHLHTPMY
FFLSNLSWVDICFSTCIVPKMLVNIQTENKAISYMDCLTQVYFSMFFPILDTLLLTVMAY
DRFVAVCHPLHYMIIMNPHLCGLLVFVTWLIGVMTSLLHISLMMHLIFCKDFEIPHFFCE
LTYILQLACSDTFLNSTLIYFMTGVLGVFPLLGIIFSYSRIASSIRKMSSSGGKQKALST
CGSHLSVVSLFYGTGIGVHFTSAVTHSSQKISVASVMYTVVTPMLNPFIYSLRNKDVKGA
LGSLLSRAASCL
NT seq 939 nt   +upstreamnt  +downstreamnt
atggaagcaggaaaccaaacaggatttttagagtttatccttctcggactctctgaggat
ccagaactacagccgttcatatttgggctgttcctgtccatgtacctggtgacggtgctg
ggaaacctgctcatcatcctggccatcagctctgactcccacctccacacccccatgtac
ttcttcctctccaacctgtcctgggttgacatctgtttcagcacttgcatcgtccccaag
atgctggtgaacatccagaccgagaacaaagccatctcctacatggactgcctcacacag
gtctatttctccatgttttttcctattctggacacgctactcctgaccgtgatggcctat
gaccggtttgtggctgtctgccaccctctgcactatatgatcatcatgaacccccacctc
tgtggcctcctggtttttgtcacctggctcattggtgtcatgacatccctcctccatatt
tctctgatgatgcatctaatcttctgtaaagattttgaaattccacattttttctgcgaa
ctgacgtacatcctccagctggcctgctctgataccttcctgaacagcacgttgatatac
tttatgacgggtgtgctgggcgtttttcccctccttgggatcattttctcttattcacga
attgcttcatccataaggaagatgtcctcatctgggggaaaacaaaaagcactttccacc
tgtgggtctcacctctccgtcgtttctttattttatgggacaggcattggggtccacttc
acttctgcggtgactcactcttcccagaaaatctccgtggcctcggtgatgtacactgtg
gtcacccccatgttgaaccccttcatctacagcctgaggaacaaggatgtgaagggagcc
ctggggagtctcctcagcagggcagcctcttgtttgtga

DBGET integrated database retrieval system