KEGG   Homo sapiens (human): 163Help
Entry
163               CDS       T01001                                 

Gene name
AP2B1, ADTB2, AP105B, AP2-BETA, CLAPB1
Definition
(RefSeq) adaptor related protein complex 2 subunit beta 1
  KO
K11825  AP-2 complex subunit beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    163 (AP2B1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    163 (AP2B1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    163 (AP2B1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    163 (AP2B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    163 (AP2B1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    163 (AP2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Cnd1 B2-adapt-app_C HEAT_2 HEAT Alpha_adaptinC2 Arm Cnd3 RTP1_C1 TIP120 Arm_2 Sec7_N
Motif
Other DBs
NCBI-GeneID: 163
NCBI-ProteinID: NP_001273
OMIM: 601025
HGNC: 563
Ensembl: ENSG00000006125
Vega: OTTHUMG00000179924
Pharos: P63010(Tbio)
UniProt: P63010
Structure
PDB: 

Position
17q12
AA seq 937 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKA
KGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQ
SIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLAT
WKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWIL
AELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtatttcacaaccaataaaaaaggagaaatatttgaactaaaagct
gaactcaacaatgaaaagaaagaaaagagaaaggaggctgtgaagaaagtgattgctgct
atgaccgtggggaaggatgttagttctctctttccagacgtagtgaactgtatgcagact
gacaatctggaactaaagaagcttgtgtatctctacttgatgaactacgccaagagtcag
ccagacatggccatcatggctgtaaacagctttgtgaaggactgtgaagatcctaatcct
ttgattcgagccttggcagtcagaaccatggggtgcatccgggtagacaaaattacagaa
tatctctgtgagccgctccgcaagtgcttgaaggatgaggatccctatgttcggaaaaca
gcagcagtctgcgtggcaaaactccatgatatcaatgcccaaatggtggaagatcaggga
tttctggattctctacgggatctcatagcagattcaaatccaatggtggtggctaatgcc
gtagcggcattatctgaaatcagtgagtctcacccaaacagcaacttacttgatctgaac
ccacagaacattaataagctgctgacagccctgaatgaatgcactgaatggggccagatt
ttcatcctggactgcctgtctaattacaaccctaaagatgatcgggaggctcagagcatc
tgtgagcgggtaactccccggctatcccatgccaactcagcagtggtgctttcagcggta
aaagtcctaatgaagtttctagaattgttacctaaggattctgactactacaatatgctg
ctgaagaagttagcccctccacttgtcactttgctgtctggggagccagaagtgcagtat
gtcgccctgaggaacatcaacttaattgtccagaaaaggcctgaaatcttgaagcaggaa
atcaaagtcttctttgtgaagtacaatgatcccatctatgttaaactagagaagttggac
atcatgattcgtttggcatctcaagccaacattgctcaggttctggcagaactgaaagaa
tatgctacagaggtggatgttgactttgttcgaaaagctgtgcgggccattggacggtgt
gccatcaaggtggagcaatctgcagagcgctgtgtaagcacattgcttgatctaatccag
accaaagtgaattatgtggtccaagaagcaattgttgtcatcagggacatcttccgcaaa
taccccaacaagtatgaaagtatcatcgccactctgtgtgagaacttagactcgctggat
gagccagatgctcgagcagctatgatttggattgtgggagaatatgctgaaagaattgac
aatgcagatgagttactagaaagcttcctggagggttttcacgatgaaagcacccaggtg
cagctcactctgcttactgccatagtgaagctgtttctcaagaaaccatcagaaacacag
gagctagtccagcaggtcttgagtttggcaacacaggattctgataatcctgaccttcga
gaccggggctatatttattggcgccttctctcaactgaccctgttacagctaaagaagta
gtcttgtctgagaagccactgatctctgaggagacggaccttattgagccaactctgctg
gatgagctaatctgccacattggttctttggcctctgtgtatcataagcctcccaatgct
tttgtggaaggaagtcatggaattcatcgtaaacacttgccaattcatcatgggagcact
gatgcaggtgacagccctgttggcactaccactgcaacgaacctggaacagcctcaggtt
atcccctctcaaggtgatcttctaggggatcttttaaaccttgacctcggtcccccagtc
aatgtgccacaggtgtcctccatgcagatgggagcagtggatctcctaggaggaggacta
gatagtctggtgggacaatccttcatcccatcatcggtgcctgcaacctttgctccttca
cctacacctgctgtggtcagcagtggactgaatgacctgtttgaactctccacagggata
ggcatggcacctggtggatatgtggctcctaaggctgtctggctacctgcagtaaaggct
aaaggcttggagatttccggaacatttactcaccgccaagggcacatctatatggaaatg
aacttcaccaataaagctctgcagcacatgacagattttgcaatccagtttaacaaaaat
agctttggtgtcatccccagcactcctctggccatccatacaccactgatgccaaaccag
agcattgatgtctccctgcctctcaataccttgggcccagtcatgaagatggaacctctg
aataacctccaggtggctgtgaaaaacaatatcgatgtcttctacttcagctgcctcatc
ccactcaatgtgctttttgtagaagatggcaaaatggagcgccaggtcttccttgcaaca
tggaaggatattcccaatgaaaatgaacttcagtttcagattaaggaatgtcatttaaat
gctgacactgtttccagcaagttgcaaaacaacaatgtttatactattgccaagaggaat
gtggaagggcaggacatgctgtaccaatccctgaagctcactaatggcatttggattttg
gccgaactacgtatccagccaggaaaccccaattacacgctgtcactgaagtgtagagct
cctgaagtctctcaatacatctatcaggtctacgacagcattttgaaaaactaa

DBGET integrated database retrieval system