KEGG   Homo sapiens (human): 163049Help
Entry
163049            CDS       T01001                                 

Gene name
ZNF791
Definition
(RefSeq) zinc finger protein 791
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05168 Herpes simplex virus 1 infection
    163049 (ZNF791)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163049 (ZNF791)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    163049 (ZNF791)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz KRAB Zn-ribbon_8 zf-trcl Zn_ribbon_SprT zf-C2H2_11 DUF3268 zf_UBZ C1_4 zf-DNA_Pol zinc_ribbon_15 zf-met
Motif
Other DBs
NCBI-GeneID: 163049
NCBI-ProteinID: NP_699189
HGNC: 26895
Ensembl: ENSG00000173875
Vega: OTTHUMG00000156426
Pharos: Q3KP31(Tdark)
UniProt: Q3KP31
Position
19p13.13
AA seq 576 aa AA seqDB search
MDSVAFEDVSVSFSQEEWALLAPSQKKLYRDVMQETFKNLASIGEKWEDPNVEDQHKNQG
RNLRSHTGERLCEGKEGSQCAENFSPNLSVTKKTAGVKPYECTICGKAFMRLSSLTRHMR
SHTGYELFEKPYKCKECEKAFSYLKSFQRHERSHTGEKPYKCKQCGKTFIYHQPFQRHER
THIGEKPYECKQCGKALSCSSSLRVHERIHTGEKPYECKQCGKAFSCSSSIRVHERTHTG
EKPYACKECGKAFISHTSVLTHMITHNGDRPYKCKECGKAFIFPSFLRVHERIHTGEKPY
KCKQCGKAFRCSTSIQIHERIHTGEKPYKCKECGKSFSARPAFRVHVRVHTGEKPYKCKE
CGKAFSRISYFRIHERTHTGEKPYECKKCGKTFNYPLDLKIHKRNHTGEKPYECKECAKT
FISLENFRRHMITHTGDGPYKCRDCGKVFIFPSALRTHERTHTGEKPYECKQCGKAFSCS
SYIRIHKRTHTGEKPYECKECGKAFIYPTSFQGHMRMHTGEKPYKCKECGKAFSLHSSFQ
RHTRIHNYEKPLECKQCGKAFSVSTSLKKHMRMHNR
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggactcagtggcttttgaggatgtgtctgtgagcttcagccaggaggagtgggctctg
ctggctccttcacagaagaaactctacagagatgtgatgcaggaaacattcaagaacctg
gcatctataggggaaaaatgggaagacccgaatgttgaagatcaacacaaaaaccaagga
cgaaatctaagaagccatacgggagagagactctgtgaaggtaaagaaggtagtcaatgt
gcagaaaacttcagtcccaatctcagtgtgacgaagaagactgccggagtaaaaccatat
gagtgtactatctgtggaaaagccttcatgcgtctctcatcccttactagacacatgagg
tctcacactggatacgagctatttgagaagccatataaatgtaaggagtgtgagaaagcc
tttagttatctcaaatcctttcaaagacatgaaaggagtcacactggagaaaaaccctat
aaatgtaaacaatgtggaaaaaccttcatatatcaccagccctttcaaagacatgagcgg
actcacattggagaaaaaccctatgaatgtaagcaatgtggaaaagctcttagttgttcc
agttcgcttcgagttcatgaaaggattcacactggagaaaagccctatgaatgtaaacaa
tgtgggaaagccttcagttgttccagttctattcgagtacacgaaagaactcacactgga
gagaaaccctatgcatgtaaggaatgtgggaaagccttcatttcccacacaagtgttcta
acacacatgataacacacaacggagatagaccttataaatgcaaagaatgtggaaaggca
ttcatttttcccagttttttacgagtacatgaaagaattcacactggagagaaaccctat
aaatgtaaacaatgtggtaaagccttcagatgttccacctccattcaaattcatgaaaga
attcatactggagagaagccctataaatgtaaagaatgtgggaaatctttcagtgcacgc
ccagcctttcgagtacacgtgagagtgcatactggagagaaaccctataagtgtaaagaa
tgtgggaaagcctttagtagaatcagttactttcgaatacatgaaaggactcacactgga
gagaaaccctacgaatgtaaaaaatgtgggaaaactttcaattatcctctagatttgaaa
atccacaagagaaatcacactggagaaaaaccctatgagtgtaaggaatgtgcaaaaacc
ttcatttctcttgagaactttcgaagacacatgatcacccacactggagacggaccttat
aaatgtagggactgtgggaaggtgttcatttttcctagtgcgttacgaacacatgaaaga
actcacactggagagaaaccctatgaatgtaaacaatgtggaaaagcctttagttgttct
agttacattcggatacataaaagaactcacactggggagaaaccttatgaatgtaaggaa
tgcgggaaggcctttatttatcccacaagctttcaaggacacatgagaatgcatactgga
gagaaaccctataaatgtaaagaatgtgggaaggcctttagtcttcacagttcctttcaa
agacatacaagaattcacaattatgagaaacctcttgaatgtaagcaatgtggaaaagcc
ttcagtgtgtccacatccttaaaaaaacatatgagaatgcacaatcgatag

DBGET integrated database retrieval system