KEGG   Homo sapiens (human): 163175Help
Entry
163175            CDS       T01001                                 

Gene name
LGI4, AMCNMY, LGIL3
Definition
(RefSeq) leucine rich repeat LGI family member 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: EPTP LRR_8 LRR_4 LRR_5 LRR_9 LRRCT
Motif
Other DBs
NCBI-GeneID: 163175
NCBI-ProteinID: NP_644813
OMIM: 608303
HGNC: 18712
Ensembl: ENSG00000153902
Vega: OTTHUMG00000044558
Pharos: Q8N135(Tbio)
UniProt: Q8N135 A5D6Y5
Position
19q13.12; 19q13.11
AA seq 537 aa AA seqDB search
MGGAGILLLLLAGAGVVVAWRPPKGKCPLRCSCSKDSALCEGSPDLPVSFSPTLLSLSLV
RTGVTQLKAGSFLRIPSLHLLLFTSNSFSVIEDDAFAGLSHLQYLFIEDNEIGSISKNAL
RGLRSLTHLSLANNHLETLPRFLFRGLDTLTHVDLRGNPFQCDCRVLWLLQWMPTVNASV
GTGACAGPASLSHMQLHHLDPKTFKCRAIELSWFQTVGESALSVEPFSYQGEPHIVLAQP
FAGRCLILSWDYSLQRFRPEEELPAASVVSCKPLVLGPSLFVLAARLWGGSQLWARPSPG
LRLAPTQTLAPRRLLRPNDAELLWLEGQPCFVVADASKAGSTTLLCRDGPGFYPHQSLHA
WHRDTDAEALELDGRPHLLLASASQRPVLFHWTGGRFERRTDIPEAEDVYATRHFQAGGD
VFLCLTRYIGDSMVMRWDGSMFRLLQQLPSRGAHVFQPLLIARDQLAILGSDFAFSQVLR
LEPDKGLLEPLQELGPPALVAPRAFAHITMAGRRFLFAACFKGPTQIYQHHEIDLSA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgggaggggcaggcattctgctgctgctgctggctggggcgggggtggtggtggcctgg
agacccccaaagggaaagtgtcccctgcgctgctcctgctctaaagacagcgccctgtgt
gagggctccccggacctgcccgtcagcttctctccgaccctgctgtcactctcactcgtc
aggacgggagtcacccagctgaaggccggcagcttcctgagaattccgtctctgcacctg
ctcctcttcacctccaactccttctccgtgattgaggacgatgcatttgcgggcctgtcc
cacctgcagtacctcttcatcgaggacaatgagattggctccatctctaagaatgccctc
agaggacttcgctcgcttacacacctaagcctggccaataaccatctggagaccctcccc
agattcctgttccgaggcctggacacccttactcatgtggacctccgcgggaacccgttc
cagtgtgactgccgcgtcctctggctcctgcagtggatgcccaccgtgaatgccagcgtg
gggaccggcgcctgtgcgggccccgcctccctgagccacatgcagctccaccacctcgac
cccaagactttcaagtgcagagccatagagctgtcctggttccagacggtgggggagtcg
gcactgagcgtagagcccttctcctaccaaggggagcctcacattgtgctggcacagccc
ttcgccggccgctgcctgattctctcctgggactacagcctgcagcgcttccggcccgag
gaagagctgcccgcggcctccgtggtgtcctgcaagccactggtgctgggcccgagcctc
ttcgtgctggctgcccgcctgtgggggggctcacagctgtgggcccggcccagtcccggc
ctgcgcctggccccaacgcagaccctggccccgcggcggctgctgcggcccaatgacgcc
gagctcctgtggctggaagggcaaccctgcttcgtggtggccgatgcctccaaggcgggc
agcaccacgctgctgtgccgcgacgggcccggcttttacccgcaccagagcctgcacgcc
tggcaccgggacacggacgctgaggccctggagctggacggccggccccacctgctgctg
gcctcggcttcccagcggcccgtgctcttccactggaccggtggccgcttcgagagacgc
acagacatccccgaggccgaggatgtctatgccacacgccacttccaggctggtggggac
gtgttcctgtgcctcacacgctacattggggactccatggtcatgcgctgggacggctcc
atgtttcgtctgctgcagcaacttccctcgcgcggtgcccacgtcttccagccactgctc
atcgccagggaccagctggccatcctaggcagcgacttcgccttcagccaggtcctccgc
cttgagcctgacaaggggctcctggagccactgcaggagctggggcctccggccctggtg
gccccccgtgcctttgcccacatcactatggccggcagacgcttcctctttgctgcttgc
tttaagggccccacacagatctaccagcatcacgagatcgacctcagtgcctga

DBGET integrated database retrieval system