KEGG   Homo sapiens (human): 163227
Entry
163227            CDS       T01001                                 

Gene name
ZNF100
Definition
(RefSeq) zinc finger protein 100
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    163227 (ZNF100)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    163227 (ZNF100)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    163227 (ZNF100)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz XPA_N zf_UBZ Zn-ribbon_8 zf-C2H2_11 zinc_ribbon_15 zf-AN1 DYW_deaminase
Other DBs
NCBI-GeneID: 163227
NCBI-ProteinID: NP_775802
OMIM: 603982
HGNC: 12880
Ensembl: ENSG00000197020
Vega: OTTHUMG00000182872
Pharos: Q8IYN0(Tdark)
UniProt: Q8IYN0
Position
19p12
AA seq 542 aa
MDDPRYGMCPLKGASGCPGAERSLLVQSYFEKGPLTFRDVAIEFSLEEWQCLDSAQQGLY
RKVMLENYRNLVFLAGIALTKPDLITCLEQGKEPWNIKRHEMVAKPPVICSHFPQDLWAE
QDIKDSFQEAILKKYGKYGHDNLQLQKGCKSVDECKVHKEHDNKLNQCLITTQSNIFQCD
PSAKVFHTFSNSNRHKIRHTRKKPFKCKKCEKSFCMLLHLTQHKRFHITENSYQCKDCGK
AFNWFSTLTTHRRIHTGEKPYKCEECGKAFNRSSHLTTHKIIHTGEKPYRCEECGKAFNR
SSHLTTHKRIHTGVKPYKCTECGKAFNRSSHLTTHRIIHTGEKPYKCEECGKAFNQSSTL
TTHKITHAGEKPYKCEECGKAFYRFSYLTKHKTSHTGEKFYKCEECGKGFNWSSALTKHK
RIHTGEKPYKCEECGKAFNESSNLTTHKMIHTGEKPYKCDECGKAFNRSSQLTAHKMIHT
GEKPYKCEECGKAFNRSSTLTKHKITHTGEKSYKWEECGKDFNQSLSLIKQNNSYWRETL
QM
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggatgacccgaggtatggaatgtgtcctctcaagggagcaagtggatgccctggggct
gagaggagtcttctggtgcagtcttattttgaaaaggggccattgacgtttagggatgtg
gccatagaattctctctggaggagtggcaatgcctggacagtgctcagcagggtttgtat
aggaaagtgatgttagagaactacagaaacctggtcttcttggcaggtattgctctcact
aagccagacctgatcacctgtctggagcaaggaaaagagccctggaatataaagagacat
gagatggtagccaaacccccagttatatgttctcattttccccaagacctttgggcagag
caggacattaaagattcttttcaagaagcgattctgaaaaaatatggaaaatatggacat
gacaatttacagttacaaaaaggctgtaaaagtgtggatgagtgtaaagtgcacaaagaa
catgataacaaattaaaccagtgtttgataactacccagagcaacatatttcaatgtgat
ccatctgcaaaagtctttcatacattttcaaattcaaacagacataagataagacatact
agaaagaaacctttcaaatgtaaaaaatgtgaaaaatcattttgcatgcttttacaccta
actcaacataaaagatttcatattacagagaattcctaccaatgtaaagattgtggcaaa
gccttcaactggttctcaacccttactacacacaggagaattcatactggagagaaaccc
tacaaatgtgaagaatgtgggaaagcatttaaccggtcctcacaccttactacacataag
ataattcatactggagagaaaccatacagatgtgaagaatgtgggaaagcttttaaccgg
tcttcacaccttactacacataaaagaattcatactggagtgaaaccctacaaatgtaca
gaatgtggcaaagcttttaaccggtcctcacaccttactacacacaggataattcatact
ggagagaaaccctacaaatgtgaagaatgtggcaaagcctttaaccagtcctcaaccctt
actacacataagataactcatgctggagagaaaccttacaaatgtgaagaatgtggcaaa
gctttttaccgattctcataccttactaaacataagacaagtcatactggagagaaattc
tacaaatgtgaagaatgcggcaaaggctttaactggtcctcagccctcactaaacataag
agaattcatactggagagaaaccctacaaatgtgaagaatgtggcaaagcttttaatgag
tcctcaaaccttactacccataagatgattcatactggagagaaaccctacaaatgtgac
gaatgtggcaaagcctttaaccggtcctcacaactaactgcacataagatgattcatact
ggagagaaaccctacaaatgtgaggaatgtggcaaagcttttaaccgatcctcaaccctt
actaaacataagataactcatactggagagaaatcttacaaatgggaagaatgtggtaaa
gactttaaccagtccctaagccttattaaacaaaataactcatactggagagaaacccta
caaatgtga

DBGET integrated database retrieval system