KEGG   Homo sapiens (human): 1634Help
Entry
1634              CDS       T01001                                 

Gene name
DCN, CSCD, DSPG2, PG40, PGII, PGS2, SLRR1B
Definition
(RefSeq) decorin
  KO
K04660  decorin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa05205  Proteoglycans in cancer
Disease
H00958  Congenital stromal corneal dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    1634 (DCN)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    1634 (DCN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    1634 (DCN)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class I
    1634 (DCN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_9 LRRNT LRR_5
Motif
Other DBs
NCBI-GeneID: 1634
NCBI-ProteinID: NP_001911
OMIM: 125255
HGNC: 2705
Ensembl: ENSG00000011465
Vega: OTTHUMG00000169998
Pharos: P07585(Tbio)
UniProt: P07585 Q6FH10
Position
12q21.33
AA seq 359 aa AA seqDB search
MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQC
HLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKV
SPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIE
LGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAAS
LKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLH
NNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccactatcatcctccttctgcttgcacaagtttcctgggctggaccgtttcaa
cagagaggcttatttgactttatgctagaagatgaggcttctgggataggcccagaagtt
cctgatgaccgcgacttcgagccctccctaggcccagtgtgccccttccgctgtcaatgc
catcttcgagtggtccagtgttctgatttgggtctggacaaagtgccaaaggatcttccc
cctgacacaactctgctagacctgcaaaacaacaaaataaccgaaatcaaagatggagac
tttaagaacctgaagaaccttcacgcattgattcttgtcaacaataaaattagcaaagtt
agtcctggagcatttacacctttggtgaagttggaacgactttatctgtccaagaatcag
ctgaaggaattgccagaaaaaatgcccaaaactcttcaggagctgcgtgcccatgagaat
gagatcaccaaagtgcgaaaagttactttcaatggactgaaccagatgattgtcatagaa
ctgggcaccaatccgctgaagagctcaggaattgaaaatggggctttccagggaatgaag
aagctctcctacatccgcattgctgataccaatatcaccagcattcctcaaggtcttcct
ccttcccttacggaattacatcttgatggcaacaaaatcagcagagttgatgcagctagc
ctgaaaggactgaataatttggctaagttgggattgagtttcaacagcatctctgctgtt
gacaatggctctctggccaacacgcctcatctgagggagcttcacttggacaacaacaag
cttaccagagtacctggtgggctggcagagcataagtacatccaggttgtctaccttcat
aacaacaatatctctgtagttggatcaagtgacttctgcccacctggacacaacaccaaa
aaggcttcttattcgggtgtgagtcttttcagcaacccggtccagtactgggagatacag
ccatccaccttcagatgtgtctacgtgcgctctgccattcaactcggaaactataagtaa

DBGET integrated database retrieval system