KEGG   Homo sapiens (human): 1635
Entry
1635              CDS       T01001                                 

Gene name
DCTD
Definition
(RefSeq) dCMP deaminase
  KO
K01493  dCMP deaminase [EC:3.5.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    1635 (DCTD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    1635 (DCTD)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.12  dCMP deaminase
     1635 (DCTD)
Secretion system [BR:hsa02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   1635 (DCTD)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam APOBEC4_like SNAD4 APOBEC3 APOBEC_N
Other DBs
NCBI-GeneID: 1635
NCBI-ProteinID: NP_001912
OMIM: 607638
HGNC: 2710
Ensembl: ENSG00000129187
Vega: OTTHUMG00000160685
Pharos: P32321(Tbio)
UniProt: P32321
Structure
PDB: 
2W4L

Position
4q35.1
AA seq 178 aa
MSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGC
SDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQA
GIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
NT seq 537 nt   +upstreamnt  +downstreamnt
atgagtgaagtttcctgcaagaaacgggacgactatttggaatggccagagtattttatg
gctgtggccttcttatcagcacagagaagcaaagatccaaattcccaggtcggcgcctgc
atcgtgaattcagaaaacaagattgtcgggattgggtacaatgggatgccaaatgggtgc
agtgatgacgtgttgccttggagaaggacagcagagaataagctggacaccaaatacccg
tacgtgtgccatgcggagctgaatgccatcatgaacaaaaattcgaccgatgtgaaaggc
tgtagtatgtatgttgccttgttcccttgtaatgaatgcgctaagctcatcatccaggca
ggtataaaagaagtgattttcatgtctgataaataccatgatagtgacgaggcaactgct
gcgaggctcctgtttaatatggccggggtgacattccggaaattcataccgaagtgcagc
aagattgtcattgactttgattcaattaacagcagaccgagtcaaaagcttcagtga

DBGET integrated database retrieval system