KEGG   Homo sapiens (human): 163589Help
Entry
163589            CDS       T01001                                 

Gene name
TDRD5, TUDOR3
Definition
(RefSeq) tudor domain containing 5
  KO
K18407  tudor domain-containing protein 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    163589 (TDRD5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  RNA silencing
   piRNA pathway
    163589 (TDRD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OST-HTH TUDOR DUF1940
Motif
Other DBs
NCBI-GeneID: 163589
NCBI-ProteinID: NP_001186020
OMIM: 617748
HGNC: 20614
Ensembl: ENSG00000162782
Vega: OTTHUMG00000035259
Pharos: Q8NAT2(Tdark)
UniProt: Q8NAT2 A0A024R910
Structure
PDB: 

Position
1q25.2
AA seq 981 aa AA seqDB search
MSEQERIQECLRKEIRSLLISTKDGLSPQELEKEYLLMVGNHLPLRILGYRSTMELVLDM
PDVVRVCPGAGGTVILKAIPDESTKGIASLVAKQRSSHKLRNSMHKGRPSIYSGPRSHRR
VPYRGRVAPILPAVVKSELKDLLALSPVLLSDFEKAFAKRFGRSFQYMQYGFLSMFEVLN
AASDVISVEQTRAGSLLMLKKSVTEEKPRGCPAGKIFTQPFRMKQGSYSTGFPVAKPCFS
QPTSNMEPPKQIMSMEKTSKLNVVETSRLNHTEKLNQLENTFKSVIAQIGPGGTISSELK
HKIKFVVSKFPEGLFISKLLGEYEVIFKEQLSPKKLGFLNVTELVGALSDILHVEFRKGH
QDLLVFDADKKPLPPVQSDKKIEAKACVSSPPRNSLSTAAVKETVWNCPSKKQKEPQQKI
CKKPNLVVKPLQLQVETNKSELNLAMANHDIPPDAVPNKKLCRLPPLDTSSLIGVFVEYI
ISPSQFYIRIYSRDSSELLEDMMIEMRRCYSNQLVSDRYVMPECFIQPGHLCCVRISEDK
WWYRVIIHRVLEKQEVEVFYPDFGNIGIVQKSSLRFLKCCYTKLPAQAIPCSLAWVRPVE
EHWTSKAILQFQKLCGLKPLVGVVDEYVDGILNIFLCDTSSNEDVYFHHVLRTEGHAIVC
RENISSKGFSELNPLALYTTSSGGPEDIVLTELGYPSQQHYFNEDRKISPQSKESELRIL
DEIPTGMPCLESVTIGDDIWDENWLPLQAKMGKGGDAASHLFTASLGGKNQYSSCKEMPQ
KDWCFSTPKDTWDDSWQPSGLVNGTKVEVHKPEVLGAQEKNTGTNRTQKQLDINGSSDSS
TLPKLEEFCTSLTQSEQSADGSQSEPNNSQTQPKQIQLSTAAPCSTTAVDDSAEKPSGSV
ESSPEILKNEDFSSSRAITLYKDKRQESVDQLSLILSYECQISQKLYIPRSTATAALGAA
ARLATSRSLLHWYPSVKRMEA
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacaagagcgtatacaggaatgtctgcggaaggaaataaggtcacttctcatt
tccaccaaagatggtttgagcccacaggagttggagaaggagtaccttttgatggttggc
aaccatctaccactccgaatccttgggtatcggtccactatggagctggtattggacatg
cctgatgttgttcgtgtctgccccggtgcaggtggtactgtaatactgaaagccattcca
gatgaatctaccaaaggaatagcaagcttagttgcaaaacagaggagcagccataagctt
cgaaactcaatgcataagggaagacctagtatttattctggaccgagatctcatcggcga
gtaccttaccgaggaagggttgcccctattcttccagctgttgtgaagagtgagttgaag
gacctgttggcgttatctcctgttcttctttctgattttgaaaaggcatttgccaaaaga
tttggacgatcattccaatacatgcaatatggatttctctctatgtttgaagtgcttaat
gcggcttcagatgtcatttctgtagagcagaccagagcaggttctttgttgatgctaaag
aagagtgtaacagaggaaaagccgagaggatgtccagcaggtaaaatttttacccagcca
tttagaatgaaacaagggtcatactccacaggctttccggtagcaaagccatgcttttca
caacccacttcaaacatggaaccaccgaagcaaataatgagcatggaaaagacttccaag
ttaaatgtagtggagacttcaagactgaatcacactgaaaaattaaaccagctggagaac
acattcaaatcagttattgcacagattggacctggaggaactatcagttcagaactaaaa
cataagataaaatttgttgtatctaagttcccagagggtttgtttatttctaaactgctt
ggagagtatgaggtaatttttaaagagcaactatcaccaaaaaaattaggcttcttaaat
gtgacagaacttgttggagctcttagtgacattctccatgttgagttcaggaaaggacac
caagacttactagtgtttgatgcggataagaagcctctaccacctgttcagtcagataag
aaaatagaagccaaagcttgtgtctccagtccacctagaaattcattgtctactgctgct
gtcaaagagactgtatggaattgcccttcaaaaaaacaaaaagagccacaacagaagatt
tgcaagaagcctaatctggtggtaaagcctttacagctgcaagtagaaacaaacaaatca
gagctcaacttggcaatggcaaatcatgacatcccgccagacgctgtgccgaacaagaaa
ttatgcagactcccaccattagacaccagttccctcataggggtctttgtggagtatatc
atctctcctagtcaattctacatccggatctatagcagggattcgtcagagttactcgaa
gacatgatgattgaaatgcggcgctgttattctaatcagctggtttctgatcgatatgtc
atgccagaatgttttattcagccgggacatctctgttgtgtaaggatttctgaggataag
tggtggtatcgggtcattatccatcgagtccttgagaaacaggaagttgaagtgttctac
ccagactttggaaatattggaattgttcagaagtcctccctgaggttcctcaagtgctgc
tacacaaagcttccagctcaggctatcccttgttctttggcttgggtgagaccagtagag
gaacactggacatcgaaagctattttgcagttccagaagttgtgcggtttgaagccatta
gtgggggtagtggatgaatatgtagatggaatccttaacatttttttgtgtgacacatcc
tcaaacgaagatgtctatttccatcatgtcttgagaacagagggccatgctattgtatgc
cgagaaaatatctcttctaagggtttcagtgagctcaaccctttagctttatacacgaca
tccagtggagggccagaggacattgtcttgacagaactgggttatccttcccagcagcac
tattttaatgaagaccgaaagataagtccacagtcaaaagagagtgagttacgtatcttg
gatgagatccccactggaatgccatgcctggagtcagtgaccataggtgatgatatttgg
gatgagaactggttacctctacaggctaagatgggaaaaggaggtgatgctgcctcccat
ctatttactgcaagccttggtggaaagaatcagtattcatcatgtaaagaaatgccacag
aaggactggtgtttttctacccctaaagatacatgggatgattcttggcagccttcaggc
cttgtaaatggaacgaaagtagaagttcataagccagaagtactgggtgctcaggaaaaa
aatactggcacaaacaggactcaaaagcaactagacataaatggttcttcagattcttcc
acactgcccaaattggaagaattctgtacctctcttacccagtcagagcagtcagcagac
gggagccagtctgaacccaacaacagtcagactcagccaaagcaaattcagctttccaca
gcagcaccctgttcaacaactgcagtggatgattccgcagaaaagccctctggttctgtg
gaaagctcaccagagatcctaaagaatgaagatttttctagcagccgtgctattacattg
tacaaagacaagcgtcaagaatctgtagaccagctgtctttgattttgtcttatgagtgc
cagatttctcagaagctctacattcctcgaagtacagccactgctgccttaggtgctgcc
gcacggttagctacatccaggagcctcctacactggtaccccagtgtgaaaaggatggaa
gcatga

DBGET integrated database retrieval system