KEGG   Homo sapiens (human): 1636Help
Entry
1636              CDS       T01001                                 

Gene name
ACE, ACE1, CD143, DCP, DCP1
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04924  Renin secretion
hsa05142  Chagas disease (American trypanosomiasis)
hsa05410  Hypertrophic cardiomyopathy (HCM)
Disease
H00083  Allograft rejection
H00575  Renal tubular dysgenesis
H01456  Diabetic nephropathy
H01457  Diabetic retinopathy
Drug target
Alacepril: D01900
Benazepril (DG00339): D00620 D07499
Benazeprilat: D03077
Captopril: D00251
Ceronapril: D03440
Cilazapril (DG00340): D01069 D07699
Delapril (DG00343): D01667 D07781
Enalapril (DG00335): D00621 D07892
Enalaprilat: D03769
Fosinopril (DG00341): D00622 D07992
Fosinoprilat: D03772
Imidapril (DG00347): D01549 D08068
Indolapril hydrochloride: D03756
Libenzapril: D03758
Lisinopril (DG00336): D00362 D08131
Moexipril (DG00344): D00623 D08225
Pentopril: D03760
Perindopril (DG00337): D00624 D03753
Pivopril: D03763
Quinapril (DG00338): D00459 D03752
Quinaprilat: D03773
Ramipril: D00421
Spirapril (DG00342): D03765 D08529
Spiraprilat: D03775
Temocapril (DG00345): D01119 D08566
Teprotide: D06076
Trandolapril: D00383
Zofenopril (DG00346): D03767 D08688
Zofenoprilat arginine: D03776
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    1636 (ACE)
   04614 Renin-angiotensin system
    1636 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    1636 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    1636 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    1636 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1636 (ACE)
   04090 CD Molecules [BR:hsa04090]
    1636 (ACE)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     1636 (ACE)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M2
   1636 (ACE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1636 (ACE)
CD molecules [BR:hsa04090]
 Proteins
  1636 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 1636
NCBI-ProteinID: NP_000780
OMIM: 106180
HGNC: 2707
Ensembl: ENSG00000159640
Vega: OTTHUMG00000154927
Pharos: P12821(Tclin)
UniProt: P12821 B4DKH4
Structure
PDB: 

Position
17q23.3
AA seq 1306 aa AA seqDB search
MGAASGRRGPGLLLPLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQV
LFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPQLRRI
IGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASSR
SYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDL
EHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPF
PDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVCH
ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRRGANPGFHEAI
GDVLALSVSTPEHLHKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS
GRTPPSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQF
HEALCKEAGYEGPLHQCDIYRSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLL
KYFQPVTQWLQEQNQQNGEVLGWPEYQWHPPLPDNYPEGIDLVTDEAEASKFVEEYDRTS
QVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRI
IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKY
EDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLER
LFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPS
APSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHAS
AWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGD
VLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGS
ITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHE
ALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSY
FKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQW
LLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcctcgggccgccgggggccggggctgctgctgccgctgccgctgctgttg
ctgctgccgccgcagcccgccctggcgttggaccccgggctgcagcccggcaacttttct
gctgacgaggccggggcgcagctcttcgcgcagagctacaactccagcgccgaacaggtg
ctgttccagagcgtggccgccagctgggcgcacgacaccaacatcaccgcggagaatgca
aggcgccaggaggaagcagccctgctcagccaggagtttgcggaggcctggggccagaag
gccaaggagctgtatgaaccgatctggcagaacttcacggacccgcagctgcgcaggatc
atcggagctgtgcgcaccctgggctctgccaacctgcccctggctaagcggcagcagtac
aacgccctgctaagcaacatgagcaggatctactccaccgccaaggtctgcctccccaac
aagactgccacctgctggtccctggacccagatctcaccaacatcctggcttcctcgcga
agctacgccatgctcctgtttgcctgggagggctggcacaacgctgcgggcatcccgctg
aaaccgctgtacgaggatttcactgccctcagcaatgaagcctacaagcaggacggcttc
acagacacgggggcctactggcgctcctggtacaactcccccaccttcgaggacgatctg
gaacacctctaccaacagctagagcccctctacctgaacctccatgccttcgtccgccgc
gcactgcatcgccgatacggagacagatacatcaacctcaggggacccatccctgctcat
ctgctgggagacatgtgggcccagagctgggaaaacatctacgacatggtggtgcctttc
ccagacaagcccaacctcgatgtcaccagtactatgctgcagcagggctggaacgccacg
cacatgttccgggtggcagaggagttcttcacctccctggagctctcccccatgcctccc
gagttctgggaagggtcgatgctggagaagccggccgacgggcgggaagtggtgtgccac
gcctcggcttgggacttctacaacaggaaagacttcaggatcaagcagtgcacacgggtc
acgatggaccagctctccacagtgcaccatgagatgggccatatacagtactacctgcag
tacaaggatctgcccgtctccctgcgtcggggggccaaccccggcttccatgaggccatt
ggggacgtgctggcgctctcggtctccactcctgaacatctgcacaaaatcggcctgctg
gaccgtgtcaccaatgacacggaaagtgacatcaattacttgctaaaaatggcactggaa
aaaattgccttcctgccctttggctacttggtggaccagtggcgctggggggtctttagt
gggcgtacccccccttcccgctacaacttcgactggtggtatcttcgaaccaagtatcag
gggatctgtcctcctgttacccgaaacgaaacccactttgatgctggagctaagtttcat
gttccaaatgtgacaccatacatcaggtactttgtgagttttgtcctgcagttccagttc
catgaagccctgtgcaaggaggcaggctatgagggcccactgcaccagtgtgacatctac
cggtccaccaaggcaggggccaagctccggaaggtgctgcaggctggctcctccaggccc
tggcaggaggtgctgaaggacatggtcggcttagatgccctggatgcccagccgctgctc
aagtacttccagccagtcacccagtggctgcaggagcagaaccagcagaacggcgaggtc
ctgggctggcccgagtaccagtggcacccgccgttgcctgacaactacccggagggcata
gacctggtgactgatgaggctgaggccagcaagtttgtggaggaatatgaccggacatcc
caggtggtgtggaacgagtatgccgaggccaactggaactacaacaccaacatcaccaca
gagaccagcaagattctgctgcagaagaacatgcaaatagccaaccacaccctgaagtac
ggcacccaggccaggaagtttgatgtgaaccagttgcagaacaccactatcaagcggatc
ataaagaaggttcaggacctagaacgggcagcactgcctgcccaggagctggaggagtac
aacaagatcctgttggatatggaaaccacctacagcgtggccactgtgtgccacccgaat
ggcagctgcctgcagctcgagccagatctgacgaatgtgatggccacgtcccggaaatat
gaagacctgttatgggcatgggagggctggcgagacaaggcggggagagccatcctccag
ttttacccgaaatacgtggaactcatcaaccaggctgcccggctcaatggctatgtagat
gcaggggactcgtggaggtctatgtacgagacaccatccctggagcaagacctggagcgg
ctcttccaggagctgcagccactctacctcaacctgcatgcctacgtgcgccgggccctg
caccgtcactacggggcccagcacatcaacctggaggggcccattcctgctcacctgctg
gggaacatgtgggcgcagacctggtccaacatctatgacttggtggtgcccttcccttca
gccccctcgatggacaccacagaggctatgctaaagcagggctggacgcccaggaggatg
tttaaggaggctgatgatttcttcacctccctggggctgctgcccgtgcctcctgagttc
tggaacaagtcgatgctggagaagccaaccgacgggcgggaggtggtctgccacgcctcg
gcctgggacttctacaacggcaaggacttccggatcaagcagtgcaccaccgtgaacttg
gaggacctggtggtggcccaccacgaaatgggccacatccagtatttcatgcagtacaaa
gacttacctgtggccttgagggagggtgccaaccccggcttccatgaggccattggggac
gtgctagccctctcagtgtctacgcccaagcacctgcacagtctcaacctgctgagcagt
gagggtggcagcgacgagcatgacatcaactttctgatgaagatggcccttgacaagatc
gcctttatccccttcagctacctcgtcgatcagtggcgctggagggtatttgatggaagc
atcaccaaggagaactataaccaggagtggtggagcctcaggctgaagtaccagggcctc
tgccccccagtgcccaggactcaaggtgactttgacccaggggccaagttccacattcct
tctagcgtgccttacatcaggtactttgtcagcttcatcatccagttccagttccacgag
gcactgtgccaggcagctggccacacgggccccctgcacaagtgtgacatctaccagtcc
aaggaggccgggcagcgcctggcgaccgccatgaagctgggcttcagtaggccgtggccg
gaagccatgcagctgatcacgggccagcccaacatgagcgcctcggccatgttgagctac
ttcaagccgctgctggactggctccgcacggagaacgagctgcatggggagaagctgggc
tggccgcagtacaactggacgccgaactccgctcgctcagaagggcccctcccagacagc
ggccgcgtcagcttcctgggcctggacctggatgcgcagcaggcccgcgtgggccagtgg
ctgctgctcttcctgggcatcgccctgctggtagccaccctgggcctcagccagcggctc
ttcagcatccgccaccgcagcctccaccggcactcccacgggccccagttcggctccgag
gtggagctgagacactcctga

DBGET integrated database retrieval system