KEGG   Homo sapiens (human): 163702Help
Entry
163702            CDS       T01001                                 

Gene name
IFNLR1, CRF2/12, IFNLR, IL-28R1, IL28RA, LICR2
Definition
(RefSeq) interferon lambda receptor 1
  KO
K05140  interferon lambda receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
Disease
H01360  Allergic rhinitis
Drug target
Peginterferon lambda-1a: D10078
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    163702 (IFNLR1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    163702 (IFNLR1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL10/28 receptor family
   163702 (IFNLR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tissue_fac
Motif
Other DBs
NCBI-GeneID: 163702
NCBI-ProteinID: NP_734464
OMIM: 607404
HGNC: 18584
Ensembl: ENSG00000185436
Vega: OTTHUMG00000003036
Pharos: Q8IU57(Tbio)
UniProt: Q8IU57
Structure
PDB: 

Position
1p36.11
AA seq 520 aa AA seqDB search
MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQ
SSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYL
FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQ
PVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWAFLVLPSLLILLL
VIAAGGVIWKTLMGNPWFQRAKMPRALDFSGHTHPVATFQPSRPESVNDLFLCPQKELTR
GVRPTPRVRAPATQQTRWKKDLAEDEEEEDEEDTEDGVSFQPYIEPPSFLGQEHQAPGHS
EAGGVDSGRPRAPLVPSEGSSAWDSSDRSWASTVDSSWDRAGSSGYLAEKGPGQGPGGDG
HQESLPPPEFSKDSGFLEELPEDNLSSWATWGTLPPEPNLVPGGPPVSLQTLTFCWESSP
EEEEEARESEIEDSDAGSWGAESTQRTEDRGRTLGHYMAR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcggggcccgagcgctggggccccctgctcctgtgcctgctgcaggccgctccaggg
aggccccgtctggcccctccccagaatgtgacgctgctctcccagaacttcagcgtgtac
ctgacatggctcccagggcttggcaacccccaggatgtgacctattttgtggcctatcag
agctctcccacccgtagacggtggcgcgaagtggaagagtgtgcgggaaccaaggagctg
ctatgttctatgatgtgcctgaagaaacaggacctgtacaacaagttcaagggacgcgtg
cggacggtttctcccagctccaagtccccctgggtggagtccgaatacctggattacctt
tttgaagtggagccggccccacctgtcctggtgctcacccagacggaggagatcctgagt
gccaatgccacgtaccagctgcccccctgcatgcccccactggatctgaagtatgaggtg
gcattctggaaggagggggccggaaacaagaccctatttccagtcactccccatggccag
ccagtccagatcactctccagccagctgccagcgaacaccactgcctcagtgccagaacc
atctacacgttcagtgtcccgaaatacagcaagttctctaagcccacctgcttcttgctg
gaggtcccagaagccaactgggctttcctggtgctgccatcgcttctgatactgctgtta
gtaattgccgcagggggtgtgatctggaagaccctcatggggaacccctggtttcagcgg
gcaaagatgccacgggccctggacttttctggacacacacaccctgtggcaacctttcag
cccagcagaccagagtccgtgaatgacttgttcctctgtccccaaaaggaactgaccaga
ggggtcaggccgacgcctcgagtcagggccccagccacccaacagacaagatggaagaag
gaccttgcagaggacgaagaggaggaggatgaggaggacacagaagatggcgtcagcttc
cagccctacattgaaccaccttctttcctggggcaagagcaccaggctccagggcactcg
gaggctggtggggtggactcagggaggcccagggctcctctggtcccaagcgaaggctcc
tctgcttgggattcttcagacagaagctgggccagcactgtggactcctcctgggacagg
gctgggtcctctggctatttggctgagaaggggccaggccaagggccgggtggggatggg
caccaagaatctctcccaccacctgaattctccaaggactcgggtttcctggaagagctc
ccagaagataacctctcctcctgggccacctggggcaccttaccaccggagccgaatctg
gtccctgggggacccccagtttctcttcagacactgaccttctgctgggaaagcagccct
gaggaggaagaggaggcgagggaatcagaaattgaggacagcgatgcgggcagctggggg
gctgagagcacccagaggaccgaggacaggggccggacattggggcattacatggccagg
tga

DBGET integrated database retrieval system