KEGG   Homo sapiens (human): 163732Help
Entry
163732            CDS       T01001                                 

Gene name
CITED4
Definition
(RefSeq) Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 4
  KO
K22528  Cbp/p300-interacting transactivator 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    163732 (CITED4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CITED
Motif
Other DBs
NCBI-GeneID: 163732
NCBI-ProteinID: NP_597724
OMIM: 606815
HGNC: 18696
Ensembl: ENSG00000179862
Vega: OTTHUMG00000007728
Pharos: Q96RK1(Tbio)
UniProt: Q96RK1
Position
1p34.2; 1p35-p34
AA seq 184 aa AA seqDB search
MADHLMLAEGYRLVQRPPSAAAAHGPHALRTLPPYAGPGLDSGLRPRGAPLGPPPPRQPG
ALAYGAFGPPSSFQPFPAVPPPAAGIAHLQPVATPYPGRAAAPPNAPGGPPGPQPAPSAA
APPPPAHALGGMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAG
SVSC
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccacctgatgctcgccgagggctaccgcctggtgcagaggccgccgtccgcc
gcggccgcccatggccctcatgcgctccggactctgccgccgtacgcgggcccgggcctg
gacagtgggctgaggccgcggggggctccgctggggccgccgccgccccgccaacccggg
gccctggcgtacggggccttcgggccgccgtcctccttccagccctttccggccgtgcct
ccgccggccgcgggcatcgcgcacctgcagcctgtggcgacgccgtaccccggccgcgcg
gccgcgccccccaacgctccgggaggccccccgggcccgcagccggcgccaagcgccgca
gccccgccgccgcccgcgcacgccctgggcggcatggacgccgaactcatcgacgaggag
gcgctgacgtcgctggagctggagctcgggctgcaccgcgtgcgcgagctgcccgagctc
ttcctgggccagagcgagttcgactgcttctcggacttggggtccgcgccgcccgccggc
tccgtgagctgctga

DBGET integrated database retrieval system