KEGG   Homo sapiens (human): 163859
Entry
163859            CDS       T01001                                 

Gene name
SDE2, C1orf55, dJ671D7.1
Definition
(RefSeq) SDE2 telomere maintenance homolog
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Telomere_Sde2_2 Sde2_N_Ubi RNA_lig_T4_1 Exonuc_VII_L
Other DBs
NCBI-GeneID: 163859
NCBI-ProteinID: NP_689821
HGNC: 26643
Ensembl: ENSG00000143751
Vega: OTTHUMG00000037504
Pharos: Q6IQ49(Tbio)
UniProt: Q6IQ49
Position
1q42.12
AA seq 451 aa
MAEAAALVWIRGPGFGCKAVRCASGRCTVRDFIHRHCQDQNVPVENFFVKCNGALINTSD
TVQHGAVYSLEPRLCGGKGGFGSMLRALGAQIEKTTNREACRDLSGRRLRDVNHEKAMAE
WVKQQAEREAEKEQKRLERLQRKLVEPKHCFTSPDYQQQCHEMAERLEDSVLKGMQAASS
KMVSAEISENRKRQWPTKSQTDRGASAGKRRCFWLGMEGLETAEGSNSESSDDDSEEAPS
TSGMGFHAPKIGSNGVEMAAKFPSGSQRARVVNTDHGSPEQLQIPVTDSGRHILEDSCAE
LGESKEHMESRMVTETEETQEKKAESKEPIEEEPTGAGLNKDKETEERTDGERVAEVAPE
ERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMALGLKCGGTLQ
ERAARLFSVRGLAKEQIDPALFAKPLKGKKK
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggcggaggccgcggcgctggtgtggattcgcggccctggcttcgggtgcaaggcggtg
cggtgtgcctcgggtcggtgcaccgtccgggattttatccaccggcactgccaagatcag
aatgttccagtggaaaacttctttgtgaaatgcaatggagcactcattaacaccagtgac
acagtgcagcatggagctgtttatagtttggaacccagactttgcggtggaaaaggaggt
tttggatctatgctccgagcacttggtgctcagattgagaagacaaccaatcgagaagct
tgtcgggatctcagtggaaggagactacgcgatgtcaatcatgaaaaagcaatggctgaa
tgggtaaaacaacaagccgagcgagaggctgaaaaggagcagaagcggctggagcgactg
cagcggaagcttgtagaacccaagcactgcttcaccagccccgactaccagcagcagtgc
catgagatggctgagcgtctggaggattccgtcctcaaaggtatgcaggctgcctccagc
aagatggtttcagcagaaatcagtgagaatcggaaacggcaatggcctactaaatctcaa
acagacagaggagccagtgcgggaaagaggagatgcttctggttgggcatggagggacta
gagactgcagaagggtccaactctgagagttcagatgatgacagtgaagaagcaccaagc
acttcaggaatgggtttccatgctccaaaaattggtagcaatggtgtcgagatggcagcc
aaatttcccagtggttctcagagggcgagagtagtgaatacagaccatggatcaccagaa
caactgcagatcccggtgactgactctgggaggcatattttagaagactcatgtgctgag
ctgggggagtccaaagagcacatggaaagcaggatggttacagaaacagaagagacccag
gagaagaaggcagagagtaaagaacccatagaagaggagcccactggggctggactgaat
aaggataaagagacagaagaaaggactgatggggaaagagttgctgaggtagcacctgaa
gaaagggaaaacgttgccgttgccaaactgcaggaaagccagccaggaaacgcagttatt
gataaggaaactatagatttattggcgttcacctctgttgcagaactggagttgctgggt
ttggagaagctcaaatgtgaactgatggcccttggactgaaatgtgggggcactctgcag
gagcgggcagcaagactcttctctgtcagaggactggcaaaggagcaaattgacccggct
ttatttgccaagcctttgaaagggaagaaaaaatga

DBGET integrated database retrieval system