KEGG   Homo sapiens (human): 1641
Entry
1641              CDS       T01001                                 

Gene name
DCX, DBCN, DC, LISX, SCLH, XLIS
Definition
(RefSeq) doublecortin
  KO
K16579  neuronal migration protein doublecortin
Organism
hsa  Homo sapiens (human)
Disease
H00268  Lissencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    1641 (DCX)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    1641 (DCX)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     1641 (DCX)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     1641 (DCX)
SSDB
Motif
Pfam: DCX
Other DBs
NCBI-GeneID: 1641
NCBI-ProteinID: NP_835365
OMIM: 300121
HGNC: 2714
Ensembl: ENSG00000077279
Vega: OTTHUMG00000022204
Pharos: O43602(Tbio)
UniProt: O43602
Structure
PDB: 

Position
Xq23
AA seq 365 aa
MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRN
GDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELE
EGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPK
LVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLH
DFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGP
MRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDS
LGDSM
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggaacttgattttggacactttgacgaaagagataagacatccaggaacatgcgaggc
tcccggatgaatgggttgcctagccccactcacagcgcccactgtagcttctaccgaacc
agaaccttgcaggcactgagtaatgagaagaaagccaagaaggtacgtttctaccgcaat
ggggaccgctacttcaaggggattgtgtacgctgtgtcctctgaccgttttcgcagcttt
gacgccttgctggctgacctgacgcgatctctgtctgacaacatcaacctgcctcaggga
gtgcgttacatttacaccattgatggatccaggaagatcggaagcatggatgaactggag
gaaggggaaagctatgtctgttcctcagacaacttctttaaaaaggtggagtacaccaag
aatgtcaatcccaactggtctgtcaacgtaaaaacatctgccaatatgaaagccccccag
tccttggctagcagcaacagtgcacaggccagggagaacaaggactttgtgcgccccaag
ctggttaccatcatccgcagtggggtgaagcctcggaaggctgtgcgtgtgcttctgaac
aagaagacagcccactcttttgagcaagtcctcactgatatcacagaagccatcaaactg
gagaccggggttgtcaaaaaactctacactctggatggaaaacaggtaacttgtctccat
gatttctttggtgatgatgatgtgtttattgcctgtggtcctgaaaaatttcgctatgct
caggatgatttttctctggatgaaaatgaatgccgagtcatgaagggaaacccatcagcc
acagctggcccaaaggcatccccaacacctcagaagacttcagccaagagccctggtcct
atgcgccgaagcaagtctccagctgactcaggtaacgaccaagacgcaaacggaacctcc
agcagccagctctctacccccaagtctaagcagtctcccatctctacgcccaccagtcct
ggcagcctccggaagcacaaggacctgtacctgcctctgtccttggatgactcggactcg
cttggtgattccatgtaa

DBGET integrated database retrieval system