KEGG   Homo sapiens (human): 1643Help
Entry
1643              CDS       T01001                                 

Gene name
DDB2, DDBB, UV-DDB2, XPE
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04115  p53 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05161  Hepatitis B
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00385  Cul4-DDB1-DDB2 complex
Network
nt06165  Epstein-Barr virus (EBV)
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
  Element
N00115  Mutation-inactivated TP53 to transcription
N00223  EBV EBNA1 to p53-mediated transcription
N00263  EBV EBNA3C to p53-mediated transcription
N00481  EBV BZLF1 to p53-mediated transcription
Disease
H00403  Disorders of nucleotide excision repair
H01428  Xeroderma pigmentosum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    1643 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    1643 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    1643 (DDB2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    1643 (DDB2)
   05202 Transcriptional misregulation in cancer
    1643 (DDB2)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    1643 (DDB2)
   05212 Pancreatic cancer
    1643 (DDB2)
   05225 Hepatocellular carcinoma
    1643 (DDB2)
   05226 Gastric cancer
    1643 (DDB2)
   05214 Glioma
    1643 (DDB2)
   05216 Thyroid cancer
    1643 (DDB2)
   05220 Chronic myeloid leukemia
    1643 (DDB2)
   05217 Basal cell carcinoma
    1643 (DDB2)
   05218 Melanoma
    1643 (DDB2)
   05213 Endometrial cancer
    1643 (DDB2)
   05224 Breast cancer
    1643 (DDB2)
   05222 Small cell lung cancer
    1643 (DDB2)
   05223 Non-small cell lung cancer
    1643 (DDB2)
  09172 Infectious diseases: Viral
   05161 Hepatitis B
    1643 (DDB2)
   05169 Epstein-Barr virus infection
    1643 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    1643 (DDB2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    1643 (DDB2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     1643 (DDB2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      1643 (DDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 1643
NCBI-ProteinID: NP_000098
OMIM: 600811
HGNC: 2718
Ensembl: ENSG00000134574
Vega: OTTHUMG00000187453
Pharos: Q92466(Tbio)
UniProt: Q92466
Structure
PDB: 

Position
11p11.2
AA seq 427 aa AA seqDB search
MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGP
QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ
EEARTRK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccgagattgtattacgccccagg
aacaagaggagcaggagtcccctggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagatgtgactcagactgcctctgggtggggctggctggccca
cagatcctgccaccatgccgcagcatcgtcaggaccctccaccagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggattct
taccggatattacaaaaggctgccccctttgacaggagggctacatccttggcgtggcac
ccaactcaccccagcaccgtggctgtgggttccaaagggggagatatcatgctctggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtttttgccagctcagacaccatc
aacatctggttttgtagcctggatgtgtctgctagtagccgaatggtggtcacaggagac
aacgtggggaacgtgatcctgctgaacatggacggcaaagagctttggaatctcagaatg
cacaaaaagaaagtgacgcatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatttgggacctgcgccaggttagagggaaagccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagcttgtttcagtcccgatgga
gcccggctcctgaccacggaccagaagagcgagatccgagtttactctgcttcccagtgg
gactgccccctgggcctgatcccgcaccctcaccgtcacttccagcacctcacacccatc
aaggcagcctggcatcctcgctacaacctcattgttgtgggccgatacccagatcctaat
ttcaaaagttgtaccccttatgaattgaggacgatcgacgtgttcgatggaaactcaggg
aagatgatgtgtcagctctatgacccagaatcttctggcatcagttcgcttaatgaattc
aatcccatgggggacacgctggcctctgcaatgggttaccacattctcatctggagccag
gaggaagccaggacacggaagtga

DBGET integrated database retrieval system