KEGG   Homo sapiens (human): 1644Help
Entry
1644              CDS       T01001                                 

Gene name
DDC, AADC
Definition
(RefSeq) dopa decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa00380  Tryptophan metabolism
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
Module
hsa_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
hsa_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Disease
H01161  Aromatic L-amino acid decarboxylase (AADC) deficiency
Drug target
Benserazide (DG01296): D01653 D03082
Carbidopa: D00558
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    1644 (DDC)
   00360 Phenylalanine metabolism
    1644 (DDC)
   00380 Tryptophan metabolism
    1644 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    1644 (DDC)
   04726 Serotonergic synapse
    1644 (DDC)
 09160 Human Diseases
  09164 Substance dependence
   05030 Cocaine addiction
    1644 (DDC)
   05031 Amphetamine addiction
    1644 (DDC)
   05034 Alcoholism
    1644 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1644 (DDC)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     1644 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     1644 (DDC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1644 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 1644
NCBI-ProteinID: NP_000781
OMIM: 107930
HGNC: 2719
Ensembl: ENSG00000132437
Vega: OTTHUMG00000023353
Pharos: P20711(Tclin)
UniProt: P20711 Q53Y41
Structure
PDB: 

Position
7p12.2-p12.1
AA seq 480 aa AA seqDB search
MNASEFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM
EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV
ATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaagtgaattccgaaggagagggaaggagatggtggattacgtggccaactac
atggaaggcattgagggacgccaggtctaccctgacgtggagcccgggtacctgcggccg
ctgatccctgccgctgcccctcaggagccagacacgtttgaggacatcatcaacgacgtt
gagaagataatcatgcctggggtgacgcactggcacagcccctacttcttcgcctacttc
cccactgccagctcgtacccggccatgcttgcggacatgctgtgcggggccattggctgc
atcggcttctcctgggcggcaagcccagcatgcacagagctggagactgtgatgatggac
tggctcgggaagatgctggaactaccaaaggcatttttgaatgagaaagctggagaaggg
ggaggagtgatccagggaagtgccagtgaagccaccctggtggccctgctggccgctcgg
accaaagtgatccatcggctgcaggcagcgtccccagagctcacacaggccgctatcatg
gagaagctggtggcttactcatccgatcaggcacactcctcagtggaaagagctgggtta
attggtggagtgaaattaaaagccatcccctcagatggcaacttcgccatgcgtgcgtct
gccctgcaggaagccctggagagagacaaagcggctggcctgattcctttctttatggtt
gccaccctggggaccacaacatgctgctcctttgacaatctcttagaagtcggtcctatc
tgcaacaaggaagacatatggctgcacgttgatgcagcctacgcaggcagtgcattcatc
tgccctgagttccggcaccttctgaatggagtggagtttgcagattcattcaactttaat
ccccacaaatggctattggtgaattttgactgttctgccatgtgggtgaaaaagagaaca
gacttaacgggagcctttagactggaccccacttacctgaagcacagccatcaggattca
gggcttatcactgactaccggcattggcagataccactgggcagaagatttcgctctttg
aaaatgtggtttgtatttaggatgtatggagtcaaaggactgcaggcttatatccgcaag
catgtccagctgtcccatgagtttgagtcactggtgcgccaggatccccgctttgaaatc
tgtgtggaagtcattctggggcttgtctgctttcggctaaagggttccaacaaagtgaat
gaagctcttctgcaaagaataaacagtgccaaaaaaatccacttggttccatgtcacctc
agggacaagtttgtcctgcgctttgccatctgttctcgcacggtggaatctgcccatgtg
cagcgggcctgggaacacatcaaagagctggcggccgacgtgctgcgagcagagagggag
tag

DBGET integrated database retrieval system