KEGG   Homo sapiens (human): 1645Help
Entry
1645              CDS       T01001                                 

Gene name
AKR1C1, 2-ALPHA-HSD, 20-ALPHA-HSD, C9, DD1, DD1/DD2, DDH, DDH1, H-37, HAKRC, HBAB, MBAB
Definition
(RefSeq) aldo-keto reductase family 1 member C1
  KO
K00212  20alpha/3alpha-hydroxysteroid dehydrogenase / dihydrodiol dehydrogenase [EC:1.1.1.149 1.1.1.357 1.3.1.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00980  Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1645 (AKR1C1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1645 (AKR1C1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.149  20alpha-hydroxysteroid dehydrogenase
     1645 (AKR1C1)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     1645 (AKR1C1)
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.20  trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
     1645 (AKR1C1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 1645
NCBI-ProteinID: NP_001344
OMIM: 600449
HGNC: 384
Ensembl: ENSG00000187134
Vega: OTTHUMG00000017580
Pharos: Q04828(Tchem)
UniProt: Q04828
Structure
PDB: 

Position
10p15.1
AA seq 323 aa AA seqDB search
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaaatatcagtgtgtgaagctgaatgatggtcacttcatgcctgtcctggga
tttggcacctatgcgcctgcagaggttcctaaaagtaaagctttagaggccaccaaattg
gcaattgaagctggcttccgccatattgattctgctcatttatacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc
tacacttcaaagctttggtgcaattcccatcgaccagagttggtccgaccagccttggaa
aggtcactgaaaaatcttcaattggattatgttgacctctaccttattcattttccagtg
tctgtaaagccaggtgaggaagtgatcccaaaagatgaaaatggaaaaatactatttgac
acagtggatctctgtgccacatgggaggccgtggagaagtgtaaagatgcaggattggcc
aagtccatcggggtgtccaacttcaaccgcaggcagctggagatgatcctcaacaagcca
gggctcaagtacaagcctgtctgcaaccaggtggaatgtcatccttacttcaaccagaga
aaactgctggatttctgcaagtcaaaagacattgttctggttgcctatagtgctctggga
tcccaccgagaagaaccatgggtggacccgaactccccggtgctcttggaggacccagtc
ctttgtgccttggcaaaaaagcacaagcgaaccccagccctgattgccctgcgctaccag
ctacagcgtggggttgtggtcctggccaagagctacaatgagcagcgcatcagacagaac
gtgcaggtgtttgaattccagttgacttcagaggagatgaaagccatagatggcctaaac
agaaatgtgcgatatttgacccttgatatttttgctggcccccctaattatccattttct
gatgaatattaa

DBGET integrated database retrieval system