KEGG   Homo sapiens (human): 164592
Entry
164592            CDS       T01001                                 
Symbol
CCDC116
Name
(RefSeq) coiled-coil domain containing 116
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4702
Other DBs
NCBI-GeneID: 164592
NCBI-ProteinID: NP_689825
HGNC: 26688
Ensembl: ENSG00000161180
Pharos: Q8IYX3(Tdark)
UniProt: Q8IYX3
Position
22:21632760..21637329
AA seq 613 aa
MARCRHHSGYLADDEASHSMCSARVQLPKKPLVPEMRPACKPGRVPHPPSTCGSSALQGQ
RRNKRHPQPFGHFLDFLTESQVLDSLETVVEKATERMAAMKTEAGVPLVEVQDPVEVPSG
GRRAHARPSLSTVHRHRVRPTLCTGHPNNYPSSSSSMSNCHSSLMAGCLGSHSRDSDLGA
QGSLPPVRDKLLLEKNLKRLLQLEREGKGLSQSCSQRDSLLWDSLGSQTSFQWTQEQPLS
WFSGLLGSSSGVPEASEPRPGEQEPIFRKREFNKEIKSLLSQLESLDLPGYCPLREPHRT
LNFLADHRLFPALQSVVSQAVDKLRGAHCRDGRPLFPTSLEPTSDLPPLGSEPAKPTNGG
QPYASPRPTVSSPKMLQRKRKDRGGSPSMSSAQVATRFKLKSPCSSSRFTKKKPLPSISS
KSSMSHFSNRLYEELADFLTQQAASLVIRKYEFEKDLSKQLGFFSFPITHVLRDLSLGLK
KVKGSRIHLSSETHRSCLLRKLEESKRARQASRLSTSHCSTETPSVQQEPATHTAQDQAT
EPCRSLYTNLPASRQLSPLEPKLYMSACTGMGSSPPKSKDMDNEGRDKAEIEDEDEDEFK
DEDQDEDKDEDGV
NT seq 1842 nt   +upstreamnt  +downstreamnt
atggccaggtgccgccaccactcgggttacctggccgatgacgaggccagccactccatg
tgcagtgcacgggtgcagctgcccaagaagccactggtcccagaaatgcggccagcctgc
aagccgggccgtgtgccacacccaccatccacatgtggcagctcagcactccagggccaa
cgccgaaacaagaggcaccctcagccctttggccactttctggatttcctaactgagagc
caggtcctggacagcctggagacagtggtggagaaggcgactgagcgcatggctgccatg
aagacggaggctggggtgccgcttgtggaggtgcaggacccagtggaggtgccaagtggt
ggacggcgggcacatgcccggcccagcctcagcaccgtacaccggcaccgtgtacggccg
accctctgcactggacaccccaacaactacccatccagctccagctccatgtccaactgc
catagcagcctcatggccggctgtctgggctcccacagccgggacagtgacctaggtgcc
caaggctcattgccacctgtgagggacaaactcctgctggagaagaacctcaagcggctg
ctacagctggagagggaagggaaaggcctcagtcagtcctgctcccagagggactccctg
ctgtgggattcgctgggtagccagaccagctttcagtggacacaggagcagcccttgtcc
tggttctcagggctgctgggctcaagctctggcgtgcctgaagcatcagagccgaggcct
ggagaacaggagccaatcttccgcaagcgagagttcaataaggagatcaagtcattactg
agccagctggagtccctcgacctgcctggctactgtccgctccgtgagccccatcgcacg
ctgaacttcctggctgaccaccgcctcttccctgccctgcaaagcgtggtcagccaggct
gtggataagctccgtggcgcccactgccgcgacggccgtcctctgttccccaccagcttg
gagcccacctcagatctgccgcctctgggctctgagccagctaaacccaccaatggcggg
cagccctatgcttccccccgccccacagtctccagccccaagatgcttcagagaaaacgc
aaggacagaggaggctccccctccatgtctagtgcccaggtggccaccagattcaaactc
aagagcccctgcagcagcagcaggttcacgaagaagaagccgctgccctccatctcgtcg
aagtccagcatgtctcacttctccaaccgcctttatgaggagctcgccgacttcctgacc
cagcaggcagcctccttggtcatccgcaagtacgagttcgaaaaggacctcagtaagcag
ctgggcttcttctccttccccatcacccacgtgctcagggacctttccctgggcttaaag
aaggtaaaaggctcccgcatccacctgtcctcggagacccaccggagctgcctgctgcgt
aaactggaggagtccaaaagggcccggcaggcctcccggctcagcacctcccactgcagc
acagagacaccctctgtgcagcaggaaccagccacccacactgcccaggaccaggccaca
gagccctgccgctccctctacaccaacttgccagccagccggcagctcagccctttggag
cccaagctctacatgtctgcctgcaccggcatgggttccagtccccccaagtccaaggac
atggacaatgagggccgtgataaagccgagattgaagatgaagatgaggatgagttcaag
gatgaagaccaggatgaggacaaggatgaggatggagtctag

DBGET integrated database retrieval system