KEGG   Homo sapiens (human): 164633
Entry
164633            CDS       T01001                                 

Gene name
CABP7, CALN2
Definition
(RefSeq) calcium binding protein 7
  KO
K23849   
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 EF-hand_4
Other DBs
NCBI-GeneID: 164633
NCBI-ProteinID: NP_872333
OMIM: 618759
HGNC: 20834
Ensembl: ENSG00000100314
Vega: OTTHUMG00000151282
Pharos: Q86V35(Tdark)
UniProt: Q86V35
Structure
PDB: 
2LV7

Position
22q12.2
AA seq 215 aa
MPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGT
AMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVF
WKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI
RQTCVRKSLICAFAIAFIISVMLIAANQVLRSGMK
NT seq 648 nt   +upstreamnt  +downstreamnt
atgccgttccacccggtgacggcggcgttgatgtaccggggcatctacaccgtgcccaac
ctgctgtcggagcagcgcccggtggacatcccggaggacgagctggaggagatccgagag
gccttcaaggtgtttgaccgtgacggcaatggcttcatctccaagcaggagctgggcaca
gccatgcgctcactgggttacatgcccaacgaggtggagctggaggtcatcatccagcgg
ctggacatggatggtgatggtcaagtggactttgaggagtttgtgacccttctgggaccc
aaactctccacctcagggatcccagagaagttccatggcaccgactttgatactgtcttc
tggaagtgcgacatgcagaagctgacggtggatgagctgaagcggctgctctacgacacc
ttctgcgagcacctgtccatgaaggacatagagaacatcatcatgacggaggaggagagc
cacctgggcacagccgaggagtgtcccgtggatgtggagacctgctccaaccagcagatc
cgccagacttgcgtgcgcaagagtctcatctgcgccttcgccatcgccttcatcatcagt
gtcatgctcattgcggccaaccaggtgctgcgcagtggcatgaagtag

DBGET integrated database retrieval system