KEGG   Homo sapiens (human): 164656Help
Entry
164656            CDS       T01001                                 

Gene name
TMPRSS6, IRIDA, MT2
Definition
(RefSeq) transmembrane serine protease 6
  KO
K09637  transmembrane protease serine 6 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Disease
H01278  Iron-refractory iron deficiency anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    164656 (TMPRSS6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     164656 (TMPRSS6)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   164656 (TMPRSS6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Ldl_recept_a SEA DUF1986 Trypsin_2 CUB DUF3709
Motif
Other DBs
NCBI-GeneID: 164656
NCBI-ProteinID: NP_705837
OMIM: 609862
HGNC: 16517
Ensembl: ENSG00000187045
Vega: OTTHUMG00000150541
Pharos: Q8IU80(Tchem)
UniProt: Q8IU80
Position
22q12.3
AA seq 802 aa AA seqDB search
MPVAEAPQVAGGQGDGGDGEEAEPEGMFKACEDSKRKARGYLRLVPLFVLLALLVLASAG
VLLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQKMLKELITST
RLGTYYNSSSVYSFGEGPLTCFFWFILQIPEHRRLMLSPEVVQALLVEELLSTVNSSAAV
PYRAEYEVDPEGLVILEASVKDIAALNSTLGCYRYSYVGQGQVLRLKGPDHLASSCLWHL
QGPKDLMLKLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVEVLASGAIMA
VVWKKGLHSYYDPFVLSVQPVVFQACEVNLTLDNRLDSQGVLSTPYFPSYYSPQTHCSWH
LTVPSLDYGLALWFDAYALRRQKYDLPCTQGQWTIQNRRLCGLRILQPYAERIPVVATAG
ITINFTSQISLTGPGVRVHYGLYNQSDPCPGEFLCSVNGLCVPACDGVKDCPNGLDERNC
VCRATFQCKEDSTCISLPKVCDGQPDCLNGSDEEQCQEGVPCGTFTFQCEDRSCVKKPNP
QCDGRPDCRDGSDEEHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRHICGGALIAD
RWVITAAHCFQEDSMASTVLWTVFLGKVWQNSRWPGEVSFKVSRLLLHPYHEEDSHDYDV
ALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGGPISNALQKVDVQLIP
QDLCSEVYRYQVTPRMLCAGYRKGKKDACQGDSGGPLVCKALSGRWFLAGLVSWGLGCGR
PNYFGVYTRITGVISWIQQVVT
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtggccgaggccccccaggtggctggcgggcagggggacggaggtgatggcgag
gaagcggagccggaggggatgttcaaggcctgtgaggactccaagagaaaagcccggggc
tacctccgcctggtgcccctgtttgtgctgctggccctgctcgtgctggcttcggcgggg
gtgctactctggtatttcctagggtacaaggcggaggtgatggtcagccaggtgtactca
ggcagtctgcgtgtactcaatcgccacttctcccaggatcttacccgccgggaatctagt
gccttccgcagtgaaaccgccaaagcccagaagatgctcaaggagctcatcaccagcacc
cgcctgggaacttactacaactccagctccgtctattcctttggggagggacccctcacc
tgcttcttctggttcattctccaaatccccgagcaccgccggctgatgctgagccccgag
gtggtgcaggcactgctggtggaggagctgctgtccacagtcaacagctcggctgccgtc
ccctacagggccgagtacgaagtggaccccgagggcctagtgatcctggaagccagtgtg
aaagacatagctgcattgaattccacgctgggttgttaccgctacagctacgtgggccag
ggccaggtcctccggctgaaggggcctgaccacctggcctccagctgcctgtggcacctg
cagggccccaaggacctcatgctcaaactccggctggagtggacgctggcagagtgccgg
gaccgactggccatgtatgacgtggccgggcccctggagaagaggctcatcacctcggtg
tacggctgcagccgccaggagcccgtggtggaggttctggcgtcgggggccatcatggcg
gtcgtctggaagaagggcctgcacagctactacgaccccttcgtgctctccgtgcagccg
gtggtcttccaggcctgtgaagtgaacctgacgctggacaacaggctcgactcccagggc
gtcctcagcaccccgtacttccccagctactactcgccccaaacccactgctcctggcac
ctcacggtgccctctctggactacggcttggccctctggtttgatgcctatgcactgagg
aggcagaagtatgatttgccgtgcacccagggccagtggacgatccagaacaggaggctg
tgtggcttgcgcatcctgcagccctacgccgagaggatccccgtggtggccacggccggg
atcaccatcaacttcacctcccagatctccctcaccgggcccggtgtgcgggtgcactat
ggcttgtacaaccagtcggacccctgccctggagagttcctctgttctgtgaatggactc
tgtgtccctgcctgtgatggggtcaaggactgccccaacggcctggatgagagaaactgc
gtttgcagagccacattccagtgcaaagaggacagcacatgcatctcactgcccaaggtc
tgtgatgggcagcctgattgtctcaacggcagcgacgaagagcagtgccaggaaggggtg
ccatgtgggacattcaccttccagtgtgaggaccggagctgcgtgaagaagcccaacccg
cagtgtgatgggcggcccgactgcagggacggctcggatgaggagcactgtgactgtggc
ctccagggcccctccagccgcattgttggtggagctgtgtcctccgagggtgagtggcca
tggcaggccagcctccaggttcggggtcgacacatctgtgggggggccctcatcgctgac
cgctgggtgataacagctgcccactgcttccaggaggacagcatggcctccacggtgctg
tggaccgtgttcctgggcaaggtgtggcagaactcgcgctggcctggagaggtgtccttc
aaggtgagccgcctgctcctgcacccgtaccacgaagaggacagccatgactacgacgtg
gcgctgctgcagctcgaccacccggtggtgcgctcggccgccgtgcgccccgtctgcctg
cccgcgcgctcccacttcttcgagcccggcctgcactgctggattacgggctggggcgcc
ttgcgcgagggcggccccatcagcaacgctctgcagaaagtggatgtgcagttgatccca
caggacctgtgcagcgaggtctatcgctaccaggtgacgccacgcatgctgtgtgccggc
taccgcaagggcaagaaggatgcctgtcagggtgactcaggtggtccgctggtgtgcaag
gcactcagtggccgctggttcctggcggggctggtcagctggggcctgggctgtggccgg
cctaactacttcggcgtctacacccgcatcacaggtgtgatcagctggatccagcaagtg
gtgacctga

DBGET integrated database retrieval system