KEGG   Homo sapiens (human): 1649Help
Entry
1649              CDS       T01001                                 

Gene name
DDIT3, C/EBPzeta, CEBPZ, CHOP, CHOP-10, CHOP10, GADD153
Definition
(RefSeq) DNA damage inducible transcript 3
  KO
K04452  DNA damage-inducible transcript 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05202  Transcriptional misregulation in cancer
Network
N00139  FUS-DDIT3 fusion to CEBPB-mediated transcription
N00140  FUS-DDIT3 fusion to NFKB-mediated transcription
Disease
H00049  Myxoid liposarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1649 (DDIT3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1649 (DDIT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    1649 (DDIT3)
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    1649 (DDIT3)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1649 (DDIT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1649 (DDIT3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    1649 (DDIT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_2 GAS bZIP_1 ATG16 DivIC Kinetocho_Slk19 GIT_CC CLZ bZIP_Maf AC_N MAJIN Neur_chan_memb APG6 RR_TM4-6 CDC45 WDCP IncA DUF5094 IFP_35_N
Motif
Other DBs
NCBI-GeneID: 1649
NCBI-ProteinID: NP_001181986
OMIM: 126337
HGNC: 2726
Ensembl: ENSG00000175197
Vega: OTTHUMG00000170046
Pharos: P35638(Tchem)
UniProt: P35638 Q53YD1
Position
12q13.3
AA seq 169 aa AA seqDB search
MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASL
AWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRM
KEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgagtcattgcctttctccttcgggacactgtccagctgggagctggaagcc
tggtatgaggacctgcaagaggtcctgtcttcagatgaaaatgggggtacctatgtttca
cctcctggaaatgaagaggaagaatcaaaaatcttcaccactcttgaccctgcttctctg
gcttggctgactgaggaggagccagaaccagcagaggtcacaagcacctcccagagccct
cactctccagattccagtcagagctccctggctcaggaggaagaggaggaagaccaaggg
agaaccaggaaacggaaacagagtggtcattccccagcccgggctggaaagcagcgcatg
aaggagaaagaacaggagaatgaaaggaaagtggcacagctagctgaagagaatgaacgg
ctcaagcaggaaatcgagcgcctgaccagggaagtagaggcgactcgccgagctctgatt
gaccgaatggtgaatctgcaccaagcatga

DBGET integrated database retrieval system