KEGG   Homo sapiens (human): 1650Help
Entry
1650              CDS       T01001                                 

Gene name
DDOST, AGER1, CDG1R, GATD6, OKSWcl45, OST, OST48, WBP1
Definition
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit
  KO
K12670  oligosaccharyltransferase complex subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00072  N-glycosylation by oligosaccharyltransferase
Network
nt06015  N-Glycan biosynthesis
  Element
N00656  DDOST deficiency in N-glycan precursor biosynthesis
N00681  N-Glycan precursor biosynthesis, ALG6 to OST
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    1650 (DDOST)
   00513 Various types of N-glycan biosynthesis
    1650 (DDOST)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1650 (DDOST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DDOST_48kD
Motif
Other DBs
NCBI-GeneID: 1650
NCBI-ProteinID: NP_005207
OMIM: 602202
HGNC: 2728
Ensembl: ENSG00000244038
Vega: OTTHUMG00000002844
Pharos: P39656(Tchem)
UniProt: P39656 A0A024RAD5
Position
1p36.12
AA seq 456 aa AA seqDB search
MGYFRCAGAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGPRTLVLLDNLNVRETH
SLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFI
DGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENL
LKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKN
TLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVF
KEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRI
DPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYER
FIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggggtacttccggtgtgcaggtgctgggtccttcggcaggaggaggaagatggagccc
agcaccgcggcccgggcttgggccctcttttggttgctgctgcccttgcttggcgcggtt
tgcgccagcggaccccgcaccttagtgctgctggacaacctcaacgtgcgggagactcat
tcgcttttcttccggagcctgaaggaccggggctttgagctcacattcaagaccgctgat
gaccccagcctgtctctcataaagtatggggaattcctctatgacaatctcatcattttc
tccccttcggtagaagattttggaggcaacatcaacgtggagaccatcagtgcctttatt
gacggcggaggcagtgtgctggtagctgccagctccgacattggtgaccctcttcgagag
ctgggcagtgagtgcgggattgagtttgacgaggagaaaacggctgtcattgaccatcac
aactatgacatctcagaccttggccagcatacgctcatcgtggctgacactgagaacctg
ctgaaggccccaaccatcgttgggaaatcatctctaaatcccatcctctttcgaggtgtt
gggatggtggccgatcctgataaccctttggtgctggacatcctgacgggctcttccacc
tcttactccttcttcccggacaagcctatcacccagtatccacatgcggtggggaagaac
accctcctcattgctgggctccaggccaggaacaatgcccgcgtcatcttcagcggctcc
ctcgacttcttcagcgactccttcttcaactcagcagtgcagaaggcggcgcccggctcc
cagaggtattcccagacaggcaactatgaactagctgtggccctctcccgctgggtgttc
aaggaggagggtgtcctccgtgtggggcctgtgtcccatcatcgggtgggcgagacagcc
ccacccaatgcctacactgtcactgacctagtggagtatagcatcgtgatccagcagctc
tcaaatggcaaatgggtcccctttgatggcgatgacattcagctggagtttgtccgcatt
gatccttttgtgaggaccttcctgaagaagaaaggtggcaaatacagtgttcagttcaag
ttgcccgacgtgtatggtgtattccagtttaaagtggattacaaccggctaggctacaca
cacctgtactcttccactcaggtatccgtgcggccactccagcacacgcagtatgagcgc
ttcatcccctcggcctacccctactacgccagcgccttctccatgatgctggggctcttc
atcttcagcatcgtcttcttgcacatgaaggagaaggagaagtccgactga

DBGET integrated database retrieval system