KEGG   Homo sapiens (human): 165140
Entry
165140            CDS       T01001                                 

Gene name
OXER1, GPCR, GPR170, TG1019
Definition
(RefSeq) oxoeicosanoid receptor 1
  KO
K10043  oxoeicosanoid receptor 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    165140 (OXER1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   HETE and oxoETE
    165140 (OXER1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 165140
NCBI-ProteinID: NP_683765
HGNC: 24884
Ensembl: ENSG00000162881
Vega: OTTHUMG00000128643
Pharos: Q8TDS5(Tchem)
UniProt: Q8TDS5
Position
2p21
AA seq 423 aa
MLCHRGGQLIVPIIPLCPEHSCRGRRLQNLLSGPWPKQPMELHNLSSPSPSLSSSVLPPS
FSPSPSSAPSAFTTVGGSSGGPCHPTSSSLVSAFLAPILALEFVLGLVGNSLALFIFCIH
TRPWTSNTVFLVSLVAADFLLISNLPLRVDYYLLHETWRFGAAACKVNLFMLSTNRTASV
VFLTAIALNRYLKVVQPHHVLSRASVGAAARVAGGLWVGILLLNGHLLLSTFSGPSCLSY
RVGTKPSASLRWHQALYLLEFFLPLALILFAIVSIGLTIRNRGLGGQAGPQRAMRVLAMV
VAVYTICFLPSIIFGMASMVAFWLSACRSLDLCTQLFHGSLAFTYLNSVLDPVLYCFSSP
NFLHQSRALLGLTRGRQGPVSDESSYQPSRQWRYREASRKAEAIGKLKVQGEVSLEKEGS
SQG
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgttgtgtcaccgtggtggccagctgatagtgccaatcatcccactttgccctgagcac
tcctgcaggggtagaagactccagaaccttctctcaggcccatggcccaagcagcccatg
gaacttcataacctgagctctccatctccctctctctcctcctctgttctccctccctcc
ttctctccctcaccctcctctgctccctctgcctttaccactgtgggggggtcctctgga
gggccctgccaccccacctcttcctcgctggtgtctgccttcctggcaccaatcctggcc
ctggagtttgtcctgggcctggtggggaacagtttggccctcttcatcttctgcatccac
acgcggccctggacctccaacacggtgttcctggtcagcctggtggccgctgacttcctc
ctgatcagcaacctgcccctccgcgtggactactacctcctccatgagacctggcgcttt
ggggctgctgcctgcaaagtcaacctcttcatgctgtccaccaaccgcacggccagcgtt
gtcttcctcacagccatcgcactcaaccgctacctgaaggtggtgcagccccaccacgtg
ctgagccgtgcttccgtgggggcagctgcccgggtggccgggggactctgggtgggcatc
ctgctcctcaacgggcacctgctcctgagcaccttctccggcccctcctgcctcagctac
agggtgggcacgaagccctcggcctcgctccgctggcaccaggcactgtacctgctggag
ttcttcctgccactggcgctcatcctctttgctattgtgagcattgggctcaccatccgg
aaccgtggtctgggcgggcaggcaggcccgcagagggccatgcgtgtgctggccatggtg
gtggccgtctacaccatctgcttcttgcccagcatcatctttggcatggcttccatggtg
gctttctggctgtccgcctgccgatccctggacctctgcacacagctcttccatggctcc
ctggccttcacctacctcaacagtgtcctggaccccgtgctctactgcttctctagcccc
aacttcctccaccagagccgggccttgctgggcctcacgcggggccggcagggcccagtg
agcgacgagagctcctaccaaccctccaggcagtggcgctaccgggaggcctctaggaag
gcggaggccatagggaagctgaaagtgcagggcgaggtctctctggaaaaggaaggctcc
tcccagggctga

DBGET integrated database retrieval system