KEGG   Homo sapiens (human): 1652Help
Entry
1652              CDS       T01001                                 

Gene name
DDT, D-DT, DDCT, MIF-2, MIF2
Definition
(RefSeq) D-dopachrome tautomerase
  KO
K10028  D-dopachrome decarboxylase [EC:4.1.1.84]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    1652 (DDT)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.84  D-dopachrome decarboxylase
     1652 (DDT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIF
Motif
Other DBs
NCBI-GeneID: 1652
NCBI-ProteinID: NP_001077861
OMIM: 602750
HGNC: 2732
Ensembl: ENSG00000099977
Vega: OTTHUMG00000150798
Pharos: P30046(Tbio)
UniProt: P30046 Q53Y51
Structure
PDB: 

Position
22q11.23
AA seq 118 aa AA seqDB search
MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQL
SISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcctggagctggacacgaatttgcccgccaaccgagtgcccgcggggctggag
aaacgactctgcgccgccgctgcctccatcctgggcaaacctgcggaccgcgtgaacgtg
acggtacggccgggcctggccatggcgctgagcgggtccaccgagccctgcgcgcagctg
tccatctcctccatcggcgtagtgggcaccgccgaggacaaccgcagccacagcgcccac
ttctttgagtttctcaccaaggagctagccctgggccaggaccggatacttatccgcttt
ttccccttggagtcctggcagattggcaagatagggacggtcatgacttttttatga

DBGET integrated database retrieval system