KEGG   Homo sapiens (human): 1655Help
Entry
1655              CDS       T01001                                 

Gene name
DDX5, G17P1, HLR1, HUMP68, p68
Definition
(RefSeq) DEAD-box helicase 5
  KO
K12823  ATP-dependent RNA helicase DDX5/DBP2 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    1655 (DDX5)
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    1655 (DDX5)
   05205 Proteoglycans in cancer
    1655 (DDX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    1655 (DDX5)
   03009 Ribosome biogenesis [BR:hsa03009]
    1655 (DDX5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     1655 (DDX5)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    1655 (DDX5)
 Complex B
    1655 (DDX5)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Helicases
    1655 (DDX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD P68HR Helicase_C ResIII ERCC3_RAD25_C Helicase_C_2
Motif
Other DBs
NCBI-GeneID: 1655
NCBI-ProteinID: NP_001307524
OMIM: 180630
HGNC: 2746
Ensembl: ENSG00000108654
Vega: OTTHUMG00000178936
Pharos: P17844(Tbio)
UniProt: P17844
Structure
PDB: 

Position
17q23.3
AA seq 614 aa AA seqDB search
MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQ
EHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAI
QAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELA
QQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLR
RTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHI
NIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRK
MRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN
SSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGS
GRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANY
TNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAA
APMIGYPMPTGYSQ
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttattcgagtgaccgagaccgcggccgggaccgagggtttggtgcacctcga
tttggaggaagtagggcagggcccttatctggaaagaagtttggaaaccctggggagaaa
ttagttaaaaagaagtggaatcttgatgagctgcctaaatttgagaagaatttttatcaa
gagcaccctgatttggctaggcgcacagcacaagaggtggaaacatacagaagaagcaag
gaaattacagttagaggtcacaactgcccgaagccagttctaaatttttatgaagccaat
ttccctgcaaatgtcatggatgttattgcaagacagaatttcactgaacccactgctatt
caagctcagggatggccagttgctctaagtggattggatatggttggagtggcacagact
ggatctgggaaaacattgtcttatttgcttcctgccattgtccacatcaatcatcagcca
ttcctagagagaggcgatgggcctatttgtttggtgctggcaccaactcgggaactggcc
caacaggtgcagcaagtagctgctgaatattgtagagcatgtcgcttgaagtctacttgt
atctacggtggtgctcctaagggaccacaaatacgtgatttggagagaggtgtggaaatc
tgtattgcaacacctggaagactgattgactttttagagtgtggaaaaaccaatctgaga
agaacaacctaccttgtccttgatgaagcagatagaatgcttgatatgggctttgaaccc
caaataaggaagattgtggatcaaataagacctgataggcaaactctaatgtggagtgcg
acttggccaaaagaagtaagacagcttgctgaagatttcctgaaagactatattcatata
aacattggtgcacttgaactgagtgcaaaccacaacattcttcagattgtggatgtgtgt
catgacgtagaaaaggatgaaaaacttattcgtctaatggaagagatcatgagtgagaag
gagaataaaaccattgtttttgtggaaaccaaaagaagatgtgatgagcttaccagaaaa
atgaggagagatgggtggcctgccatgggtatccatggtgacaagagtcaacaagagcgt
gactgggttctaaatgaattcaaacatggaaaagctcctattctgattgctacagatgtg
gcctccagagggctagatgtggaagatgtgaaatttgtcatcaattatgactaccctaac
tcctcagaggattatattcatcgaattggaagaactgctcgcagtaccaaaacaggcaca
gcatacactttctttacacctaataacataaagcaagtgagcgaccttatctctgtgctt
cgtgaagctaatcaagcaattaatcccaagttgcttcagttggtcgaagacagaggttca
ggtcgttccaggggtagaggaggcatgaaggatgaccgtcgggacagatactctgcgggc
aaaaggggtggatttaatacctttagagacagggaaaattatgacagaggttactctagc
ctgcttaaaagagattttggggcaaaaactcagaatggtgtttacagtgctgcaaattac
accaatgggagctttggaagtaattttgtgtctgctggtatacagaccagttttaggact
ggtaatccaacagggacttaccagaatggttatgatagcactcagcaatacggaagtaat
gttccaaatatgcacaatggtatgaaccaacaggcatatgcatatcctgctactgcagct
gcacctatgattggttatccaatgccaacaggatattcccaataa

DBGET integrated database retrieval system