KEGG   Homo sapiens (human): 166Help
Entry
166               CDS       T01001                                 

Gene name
TLE5, AES, AES-1, AES-2, ESP1, GRG, GRG5, Grg-5
Definition
(RefSeq) TLE family member 5, transcriptional modulator
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TLE_N HALZ FliG_N
Motif
Other DBs
NCBI-GeneID: 166
NCBI-ProteinID: NP_001121
OMIM: 600188
HGNC: 307
Ensembl: ENSG00000104964
Vega: OTTHUMG00000180567
Pharos: Q08117(Tbio)
UniProt: Q08117 Q8WY48
Position
19p13.3
AA seq 197 aa AA seqDB search
MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRH
YVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELN
SIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDK
NGHDGDTHQEDDGEKSD
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttccacaaagcaggcattcgggctcctcgcacctaccccagcaactcaaattc
accacctcggactcctgcgaccgcatcaaagacgaatttcagctactgcaagctcagtac
cacagcctcaagctcgaatgtgacaagttggccagtgagaagtcagagatgcagcgtcac
tatgtgatgtactacgagatgtcctacggcttgaacatcgagatgcacaaacaggctgag
atcgtcaaaaggctgaacgggatttgtgcccaggtcctgccctacctctcccaagagcac
cagcagcaggtcttgggagccattgagagggccaagcaggtcaccgctcccgagctgaac
tctatcatccgacagcagctccaagcccaccagctgtcccagctgcaggccctggccctg
cccttgaccccactacccgtggggctgcagccgccttcgctgccggcggtcagcgcaggc
accggcctcctctcgctgtccgcgctgggttcccaggcccacctctccaaggaagacaag
aacgggcacgatggtgacacccaccaggaggatgatggcgagaagtcggattag

DBGET integrated database retrieval system