KEGG   Homo sapiens (human): 1660Help
Entry
1660              CDS       T01001                                 

Gene name
DHX9, DDX9, LKP, NDH2, NDHII, RHA
Definition
(RefSeq) DExH-box helicase 9
  KO
K13184  ATP-dependent RNA helicase A [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    1660 (DHX9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     1660 (DHX9)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    1660 (DHX9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dsrm HA2 Helicase_C OB_NTP_bind DEAD Dicer_dimer T2SSE AAA_14 ResIII AAA_22 ATPase PhoH AAA_19
Motif
Other DBs
NCBI-GeneID: 1660
NCBI-ProteinID: NP_001348
OMIM: 603115
HGNC: 2750
Ensembl: ENSG00000135829
Vega: OTTHUMG00000035337
Pharos: Q08211(Tbio)
UniProt: Q08211 B3KU66
Structure
PDB: 

Position
1q25.3
AA seq 1270 aa AA seqDB search
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSN
AARDFVNYLVRINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALK
AENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLEN
AKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQ
SCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPP
PEDPSVPVALNIGKLAQFEPSQRQNQVGVVPWSPPQSNWNPWTSSNIDEGPLAFATPEQI
SMDLKNELMYQLEQDHDLQAILQERELLPVKKFESEILEAISQNSVVIIRGATGCGKTTQ
VPQFILDDFIQNDRAAECNIVVTQPRRISAVSVAERVAFERGEEPGKSCGYSVRFESILP
RPHASIMFCTVGVLLRKLEAGIRGISHVIVDEIHERDINTDFLLVVLRDVVQAYPEVRIV
LMSATIDTSMFCEYFFNCPIIEVYGRTYPVQEYFLEDCIQMTHFVPPPKDKKKKDKDDDG
GEDDDANCNLICGDEYGPETRLSMSQLNEKETPFELIEALLKYIETLNVPGAVLVFLPGW
NLIYTMQKHLEMNPHFGSHRYQILPLHSQIPREEQRKVFDPVPVGVTKVILSTNIAETSI
TINDVVYVIDSCKQKVKLFTAHNNMTNYATVWASKTNLEQRKGRAGRVRPGFCFHLCSRA
RFERLETHMTPEMFRTPLHEIALSIKLLRLGGIGQFLAKAIEPPPLDAVIEAEHTLRELD
ALDANDELTPLGRILAKLPIEPRFGKMMIMGCIFYVGDAICTIAAATCFPEPFINEGKRL
GYIHRNFAGNRFSDHVALLSVFQAWDDARMGGEEAEIRFCEHKRLNMATLRMTWEAKVQL
KEILINSGFPEDCLLTQVFTNTGPDNNLDVVISLLAFGVYPNVCYHKEKRKILTTEGRNA
LIHKSSVNCPFSSQDMKYPSPFFVFGEKIRTRAISAKGMTLVTPLQLLLFASKKVQSDGQ
IVLVDDWIKLQISHEAAACITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISR
PSAAGINLMIGSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYSSGGYGSGGYG
GSANSFRAGYGAGVGGGYRGVSRGGFRGNSGGDYRGPSGGYRGSGGFQRGGGRGAYGTGY
FGQGRGGGGY
NT seq 3813 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgttaaaaattttctgtatgcctggtgtggcaaaaggaagatgaccccatcc
tatgaaattagagcagtggggaacaaaaacaggcagaaattcatgtgtgaggttcaggtg
gaaggttataattacactggcatgggaaattccaccaataaaaaagatgcacaaagcaat
gctgccagagactttgttaactatttggttcgaataaatgaaataaagagtgaagaagtt
ccagcttttggggtagcatctccgcccccacttactgatactcctgacactacagcaaat
gctgaaggagatttaccaacaaccatgggaggacctcttcctccacatctggctctcaaa
gcagaaaataattctgaggtaggggcctctggctatggtgttcctgggcccacctgggac
cgaggagccaacttgaaggattactactcaagaaaggaagaacaagaagtgcaagcgact
ctagaatcagaagaagtggatttaaatgctgggcttcatggaaactggaccttggaaaat
gctaaagctcgtctaaaccaatattttcagaaagaaaagatccaaggagaatataagtac
acccaagtgggtcctgatcacaacaggagctttattgcagaaatgaccatttatatcaag
cagctgggcagaaggatttttgcacgagaacatggatcaaataagaaattggcagcacag
tcctgtgccctgtcacttgtcagacaactgtaccatcttggagtggttgaagcttactcc
ggacttacaaagaagaaggaaggagagacagtggagccttacaaagtaaacctctctcaa
gatttagagcatcagctgcaaaacatcattcaagagctaaatcttgagattttgcccccg
cctgaagatccttctgtgccagttgcactcaacattggcaaattggctcagttcgaacca
tctcagcgacaaaaccaagtgggtgtggttccttggtcacctccacaatccaactggaat
ccttggactagtagcaacattgatgaggggcctctggcttttgctactccagagcaaata
agcatggacctcaagaatgaattgatgtaccagttggaacaggatcatgatttgcaagca
atcttgcaggagagagagttactgcctgtgaagaaatttgaaagtgagattctggaagca
atcagccaaaattcagttgtcattattagaggggctactggatgtgggaaaaccacacag
gttccccagttcattctagatgactttatccagaatgaccgagcagcagagtgtaacatc
gtagtaactcagcccagaagaatcagtgcggtttctgtggcagagcgagttgcatttgaa
agaggagaagagcctggaaaaagctgtggctacagcgttcgatttgagtctatacttcct
cgtcctcatgccagtataatgttttgtactgtaggtgtgctcctgagaaaattagaagca
ggcattcgaggaatcagtcatgtaattgtagatgaaatacatgaaagagatattaatact
gacttccttttggtagtactgcgtgatgttgttcaggcttatcctgaagttcgcattgtt
cttatgtctgctactattgataccagcatgttttgtgaatatttcttcaattgccccatc
attgaagtttatgggaggacttacccagttcaagaatattttctggaagactgcattcag
atgacccactttgttcctccaccaaaagacaaaaagaagaaggataaggatgatgatggt
ggtgaggatgatgatgcaaattgcaacttgatctgtggtgatgaatatggtccagaaaca
aggttgagcatgtctcaattgaacgaaaaggaaactccttttgaactcatcgaggctcta
cttaagtacattgaaacccttaatgttcctggagctgtgttggtttttttgcctggctgg
aatctgatttatactatgcagaagcatttggaaatgaatccacattttggaagccatcgg
tatcagattctacccctgcattctcagattcctcgagaggaacagcgcaaagtgtttgat
ccagtaccagttggagtaaccaaggttattttgtccacaaatattgctgaaacaagcatt
accataaacgatgttgtttatgtcattgactcctgcaagcagaaagtgaaactcttcact
gctcacaacaatatgaccaactatgctaccgtatgggcatcaaaaacaaaccttgagcaa
cggaaagggcgagctggccgagtacggcctggattctgctttcacctgtgcagccgagct
cgttttgagagacttgaaacccacatgacaccagagatgttccgaacaccattgcatgaa
attgctcttagcataaaacttctgcgtctaggaggaattggccaatttctggccaaagca
attgaacctccccctttggatgctgtgattgaagcagaacacactcttagagagcttgat
gcattagatgccaatgatgagttgactcctttgggacgaatcctggctaaactccccatt
gagcctcgttttggcaaaatgatgataatggggtgtattttctacgtgggagatgctatc
tgtaccattgctgctgctacctgctttccagagcctttcatcaatgaaggaaagcggctg
ggctatatccatcgaaattttgctggaaacagattttctgatcacgtagcccttttatca
gtattccaagcctgggatgatgctagaatgggtggagaagaagcagagatacgtttttgt
gagcacaaaagacttaatatggctacactaagaatgacttgggaagccaaagttcagctc
aaagagattttgattaattctgggtttccagaagattgtttgttgacacaagtgtttact
aacactggaccagataataatttggatgttgttatctccctcctggcctttggtgtgtac
cccaatgtatgctatcataaggaaaagaggaagattctcaccactgaagggcgtaatgca
cttatccacaaatcatctgttaattgtccttttagtagccaagacatgaagtacccatct
cccttctttgtatttggtgaaaagattcgaactcgagccatctctgctaaaggcatgact
ttagtcacccccctgcagttgcttctctttgcctccaagaaagtccaatctgatgggcag
attgtgcttgtagatgactggattaaactgcaaatatctcatgaagctgctgcctgtatc
actggtctccgggcagccatggaggctttggttgttgaagtaaccaaacaacctgctatc
atcagccagttggaccccgtaaatgaacgtatgctgaacatgatccgtcagatctctaga
ccctcagctgctggtatcaaccttatgattggcagtacacggtatggagatggtccacgt
cctcccaagatggcccgatacgacaatggaagcggatatagaaggggaggttctagttac
agtggtggaggctatggcggtggctatagcagtggaggctatggtagcggaggctatggt
ggcagcgccaactcctttcgggcaggatatggtgcaggtgttggtggaggctatagagga
gtttcccgaggtggctttagaggcaactctggaggagactacagagggcctagtggaggc
tacagaggatctgggggattccagcgaggaggtggtaggggggcctatggaactggctac
tttggacagggaagaggaggtggcggctattaa

DBGET integrated database retrieval system