KEGG   Homo sapiens (human): 166012
Entry
166012            CDS       T01001                                 

Gene name
CHST13, C4ST3
Definition
(RefSeq) carbohydrate sulfotransferase 13
  KO
K07779  chondroitin 4-sulfotransferase 13 [EC:2.8.2.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    166012 (CHST13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    166012 (CHST13)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.5  chondroitin 4-sulfotransferase
     166012 (CHST13)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   166012 (CHST13)
SSDB
Motif
Pfam: Sulfotransfer_2
Other DBs
NCBI-GeneID: 166012
NCBI-ProteinID: NP_690849
OMIM: 610124
HGNC: 21755
Ensembl: ENSG00000180767
Vega: OTTHUMG00000162721
Pharos: Q8NET6(Tbio)
UniProt: Q8NET6
Position
3q21.3
AA seq 341 aa
MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQ
DPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNW
KRVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERL
ASAYRNKLARPYSAAFQRRYGARIVQRLRPRALPDARARGHDVRFAEFLAYLLDPRTRRE
EPFNEHWERAHALCHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAAS
RDLAARLFRDISPFYQRRLFDLYKMDFLLFNYSAPSYLRLL
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggggaggcgctgctgccggcggcgcgtgctggcggccgcctgtctgggcgccgcgctc
ctgctcctatgcgccgcgccccgctccctgcgcccggcatttggaaacagagccctgggc
tccagctggcttggtggggagaagagaagccccctgcagaagctctatgacctggatcag
gacccgcgctcgaccctggcgaaggtgcaccggcagcggcgcgacctgctgaacagcgcc
tgtagccgccactcacgccggcagcgcctgctacagccggaggacctgcggcacgtgctg
gtggacgacgcgcatggcctgctctactgctacgtgcccaaggtggcctgcaccaactgg
aagcgcgtgctgctggcgctgagcggccaagcccgcggcgacccgcgcgccatctccgcg
caagaggcgcacgcgcctggccgcctgccctcactggccgacttcagccccgccgagatc
aaccggcgcctgcgcgcctacttggccttcctgttcgtgcgggagcccttcgagcgcctg
gcatcggcttaccgcaacaagctcgcgcgcccctacagcgccgccttccagaggcgctac
ggtgcacgcatcgttcagcgcctgcggccgcgcgcgctccccgacgcccgggcccgcggc
cacgacgtgcgcttcgcggagttcctggcctacctgctggacccgcgcacgcggcgtgag
gagcccttcaacgagcactgggagcgcgcgcacgcgctctgccacccgtgtcgcctccgc
tacgacgtcgtgggcaagttcgagacgctggcggaggacgcggccttcgtgctgggcctg
gcgggcgcatccgacctgagcttccctgggccgccgcggccccggggagccgccgcctcc
cgcgacctggcagcgcgcctcttccgggacatcagccccttctaccagcggcgcctcttc
gacctctacaagatggacttcctgcttttcaactactccgccccctcctacctgcggctg
ctctag

KEGG   Homo sapiens (human): 50515
Entry
50515             CDS       T01001                                 

Gene name
CHST11, C4ST, C4ST-1, C4ST1, HSA269537, OCBMD
Definition
(RefSeq) carbohydrate sulfotransferase 11
  KO
K01017  chondroitin 4-sulfotransferase 11 [EC:2.8.2.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    50515 (CHST11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    50515 (CHST11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.5  chondroitin 4-sulfotransferase
     50515 (CHST11)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   50515 (CHST11)
SSDB
Motif
Pfam: Sulfotransfer_2
Other DBs
NCBI-GeneID: 50515
NCBI-ProteinID: NP_060883
OMIM: 610128
HGNC: 17422
Ensembl: ENSG00000171310
Vega: OTTHUMG00000169803
Pharos: Q9NPF2(Tbio)
UniProt: Q9NPF2 A0A024RBL0
Position
12q23.3
AA seq 352 aa
MKPALLEVMRMNRICRMVLATCLGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPL
QELYNPIQLELSNTAVLHQMRRDQVTDTCRANSATSRKRRVLTPNDLKHLVVDEDHELIY
CYVPKVACTNWKRLMMVLTGRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYM
KFLFVREPFERLVSAYRNKFTQKYNISFHKRYGTKIIKRQRKNATQEALRKGDDVKFEEF
VAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLK
FPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLKLE
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaagccagcgctgctggaagtgatgaggatgaacagaatctgccggatggtgctggcc
acttgcttgggatcctttatcctggtcatcttctatttccaaagtatgttgcacccagtc
atgcggaggaatccctttggtgtggacatctgctgccggaaggggtcccgaagccccctg
caggaactctacaacccaatccagctggagctctcaaacactgctgtcctgcaccagatg
cggcgggaccaggtgacagacacgtgccgagccaacagcgccacaagccgtaagcggagg
gtgctgacccccaacgacctgaagcacttggtggtggatgaggaccacgagctcatctac
tgctacgtgcccaaggtggcctgcaccaactggaagcggctcatgatggtcctgaccggg
cgggggaagtacagcgaccccatggagatcccggccaacgaggcacacgtctccgccaac
ctgaagaccctgaaccagtacagcatcccagaaatcaaccaccgcttgaaaagctacatg
aagttcctgtttgtccgggagcccttcgagaggctagtgtccgcctaccgcaacaagttc
acccagaagtacaacatctccttccacaagcggtacggcaccaagatcatcaaacgccag
cggaagaacgccacccaggaggccctgcgcaaaggggacgatgtcaaattcgaggagttt
gtggcctatctcatcgacccacacacccagcgggaggagcctttcaacgaacactggcaa
accgtctactcactctgccatccctgccacatccactatgacctcgtgggcaagtacgag
acactggaagaggattctaattacgtcctgcagctggcaggagtgggcagctacctgaag
ttccccacctatgcaaagtctacgagaactactgatgaaatgaccacagaattcttccag
aacatcagctcagagcaccaaacgcagctgtacgaagtctacaaactcgattttttaatg
ttcaattactcagtgccaagctacctgaaattggaataa

KEGG   Homo sapiens (human): 55501
Entry
55501             CDS       T01001                                 

Gene name
CHST12, C4S-2, C4ST-2, C4ST2
Definition
(RefSeq) carbohydrate sulfotransferase 12
  KO
K04742  chondroitin 4-sulfotransferase 12 [EC:2.8.2.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    55501 (CHST12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    55501 (CHST12)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.5  chondroitin 4-sulfotransferase
     55501 (CHST12)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   55501 (CHST12)
SSDB
Motif
Pfam: Sulfotransfer_2
Other DBs
NCBI-GeneID: 55501
NCBI-ProteinID: NP_001230723
OMIM: 610129
HGNC: 17423
Ensembl: ENSG00000136213
Vega: OTTHUMG00000023849
Pharos: Q9NRB3(Tbio)
UniProt: Q9NRB3 A0A024R860
Position
7p22.3
AA seq 414 aa
MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHTGPPLPTPGPDRDREL
TADSDVDEFLDKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQ
QAERRSVLRGFCANSSLAFPTKERAFDDIPNSELSHLIVDDRHGAIYCYVPKVACTNWKR
VMIVLSGSLLHRGAPYRDPLRIPREHVHNASAHLTFNKFWRRYGKLSRHLMKVKLKKYTK
FLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYANHTSLPASAREAFRAGLKVSF
ANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVGKLETLDEDAAQLLQLLQVDR
QLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgaccaaggcccggctgttccggctgtggctggtgctggggtcggtgttcatgatcctg
ctgatcatcgtgtactgggacagcgcaggcgccgcgcacttctacttgcacacgtccttc
tctaggccgcacacggggccgccgctgcccacgcccgggccggacagggacagggagctc
acggccgactccgatgtcgacgagtttctggacaagtttctcagtgctggcgtgaagcag
agcgaccttcccagaaaggagacggagcagccgcctgcgccggggagcatggaggagagc
gtgagaggctacgactggtccccgcgcgacgcccggcgcagcccagaccagggccggcag
caggcggagcggaggagcgtgctgcggggcttctgcgccaactccagcctggccttcccc
accaaggagcgcgcattcgacgacatccccaactcggagctgagccacctgatcgtggac
gaccggcacggggccatctactgctacgtgcccaaggtggcctgcaccaactggaagcgc
gtgatgatcgtgctgagcggaagcctgctgcaccgcggtgcgccctaccgcgacccgctg
cgcatcccgcgcgagcacgtgcacaacgccagcgcgcacctgaccttcaacaagttctgg
cgccgctacgggaagctctcccgccacctcatgaaggtcaagctcaagaagtacaccaag
ttcctcttcgtgcgcgaccccttcgtgcgcctgatctccgccttccgcagcaagttcgag
ctggagaacgaggagttctaccgcaagttcgccgtgcccatgctgcggctgtacgccaac
cacaccagcctgcccgcctcggcgcgcgaggccttccgcgctggcctcaaggtgtccttc
gccaacttcatccagtacctgctggacccgcacacggagaagctggcgcccttcaacgag
cactggcggcaggtgtaccgcctctgccacccgtgccagatcgactacgacttcgtgggg
aagctggagactctggacgaggacgccgcgcagctgctgcagctactccaggtggaccgg
cagctccgcttccccccgagctaccggaacaggaccgccagcagctgggaggaggactgg
ttcgccaagatccccctggcctggaggcagcagctgtataaactctacgaggccgacttt
gttctcttcggctaccccaagcccgaaaacctcctccgagactga

DBGET integrated database retrieval system